Identifiers and Description

Gene Model Identifier

TTHERM_01029960

Standard Name

MDH4 (malate dehydrogenase 4)

Aliases

PreTt10826 | 204.m00055

Description

malate dehydrogenase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( TIGR01759 ) malate dehydrogenase
  • ( TIGR01756 ) lactate dehydrogenase
  • ( TIGR01758 ) malate dehydrogenase, NAD-dependent
  • ( TIGR01763 ) malate dehydrogenase, NAD-dependent
  • ( TIGR01772 ) malate dehydrogenase, NAD-dependent
  • ( TIGR01757 ) malate dehydrogenase, NADP-dependent
  • ( PF00056 ) lactate/malate dehydrogenase, NAD binding domain
  • ( PF02866 ) lactate/malate dehydrogenase, alpha/beta C-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_01029960

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10494.19.997093137033517e-262malate dehydrogenase (337 aa)
DictyBaseDDB_G02802556.996525358388811e-93mdhC on chromosome: 3 position
3171359 to 3172577
OxytrichaContig22377.0.g621.0002434920975502e-91lactate/malate dehydrogenase,
alpha/beta C-terminal domain
WormBaseWBGene000184914.999773105566236e-81locus:mdh-1 Malate dehydroge
nase status:Confirmed UniP
rot:Q9UAV5 protein_id:CCD713
16.1
Stentor CoeruleusSteCoe_188802.506567475899953e-46
SGDYKL085W0.0000000000002999981760818895MDH1 Mitochondrial malate dehy
drogenase, catalyzes interconv
ersion of malate and oxaloacet
ate; involved in the tricarbox
ylic acid (TCA) cycle; phospho
rylated

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01029960(coding)
ATGATAAAAGAATACTTTTTTTAGAATTATTATTTATTTTAATTTATTCCAAAAAAAACA
TAAATAAATGGTATGATTTAAAAATAATTATTTTTGGTAGAATATGTTAGATAGGAAGGA
TATAAAATTTTTATTATTTTATATGCAAATATGCAACCATCATTTTTCTTTAGAAATTAA
GATAGCATAAATGTTAAGCACTTTAGACATATAAAGCATGCATACGCATATTTACATACA
GGATGTGTCTATTTATAATCCGTCAAAGGATTAGCACCAACAAAGATAGAACGAGTCATT
TAGGTTTAACGAGAATCATATTATGATTAAGTCATCTATCATGATCCTAATTAAAAATCA
AATAAAAAAGTGATCAATTAAATTAGTAAAGATAAAAGAAAAAATAAATAAACAAATATC
AGGATTTACTAAAAAATTAAAAAGGAAAGAAAATTAGTTTAACTTTTACTTTTTGATAAT
TTAATTTCTGGTACTTAGTTATTTTTAGAAATAAAAGAAAAAAATAATTAATTAATTTGC
AAAAACATTTAAAAGAAATTAAAAGTATTTATCATTTTTAAAAAAAATATAAAACATATT
TTAGAAGTTATGGAGAATAAAGCAGTTATTAATGTTTGTATTACAGGCGCTGCTGGTAAT
ATTGCATACGCCTTGTATTCTATATTGTGCACTGGCCAAATATTTGGGTCTAATCAAAAA
ATGAACTTAAAGCTTTTAGATATTGAATCTCAAGCAAAGGGTCTTTAAGGAGTTGCATTA
GAATTAGAAGATTGCGCCTATGCCCTCGTTAATTCGATAGAGTACGGTTTTGACCCCGAA
GTACTTTTCAAAGATATGGATGTTGGCATTTTCCTCGGAGGGTAATCAAGAAGACCTGGT
ATGGAAAGAGTTGATTTACTTTAAGTAAATAACAGAATTTTCAAGATCTAGGGTAAAGCT
TTGAATAAAGTAGCTAAGCCAAGCACTAAGATTCTAGTAATCGCAAATCCAGTAAACACA
AATTGCTTAACTTTGATTCAAAATTGTCCTAACATTCCTAAAGAAAATTTCACTTGCTTG
ACAAGACTTGACCACAATAGAGCAATAGCATAATTAGCAATCAAAGCAAAAGTACCTGTT
ACCGAAGTTAAAAATGTTATTCTATGGGGTAACCATAGTTTAACTATGTATCCAGATCAC
AATCATGCACACATTGAAGGTCAACCAGCAGTAGATATATATGAAGAGGAATGGATTAAG
AATACTTTCATTCCTAAAGTTTAAAAAAGGGGAGGAGAAGTTCTAAATTTGAGATAGAAC
TCCTCAGTTATGAGTGCTGCAATTGCTATTCGTGACCACTTAGTTAATTGGATTTATGGA
ACTCCTGAAGGATAGTTCGTATCTATGGGTGTTTACACTGACGGAAGCTTCTATGATATT
CCCGCAGATTTTGTTTTCTCAGTTCCAGTTAAGTGCAAAGACTTTAAATACGAAGTTGTT
AAGGATTTGACTATTAGCTAGTTTTCAAGATAAAAAATTAACATCAGTTTGAGAGAATTG
TAAGATGAGAAAGAAGAAGCTAACTGCTACGACGATGATGCTGAAGACGAATCTGAAGAG
TGA


>TTHERM_01029960(protein)
MIKEYFFQNYYLFQFIPKKTQINGMIQKQLFLVEYVRQEGYKIFIILYANMQPSFFFRNQ
DSINVKHFRHIKHAYAYLHTGCVYLQSVKGLAPTKIERVIQVQRESYYDQVIYHDPNQKS
NKKVINQISKDKRKNKQTNIRIYQKIKKERKLVQLLLFDNLISGTQLFLEIKEKNNQLIC
KNIQKKLKVFIIFKKNIKHILEVMENKAVINVCITGAAGNIAYALYSILCTGQIFGSNQK
MNLKLLDIESQAKGLQGVALELEDCAYALVNSIEYGFDPEVLFKDMDVGIFLGGQSRRPG
MERVDLLQVNNRIFKIQGKALNKVAKPSTKILVIANPVNTNCLTLIQNCPNIPKENFTCL
TRLDHNRAIAQLAIKAKVPVTEVKNVILWGNHSLTMYPDHNHAHIEGQPAVDIYEEEWIK
NTFIPKVQKRGGEVLNLRQNSSVMSAAIAIRDHLVNWIYGTPEGQFVSMGVYTDGSFYDI
PADFVFSVPVKCKDFKYEVVKDLTISQFSRQKINISLRELQDEKEEANCYDDDAEDESEE


>TTHERM_01029960(gene)
CAAAGTATATAAAATTGAGAAGTGTATTTTCAATATTTAAATGATAAAAGAATACTTTTT
TTAGAATTATTATTTATTTTAATTTATTCCAAAAAAAACATAAATAAATGGTATGATTTA
AAAATAATTATTTTTGGTAGAATATGTTAGATAGGAAGGATATAAAATTTTTATTATTTT
ATATGCAAATATGCAACCATCATTTTTCTTTAGAAATTAAGATAGCATAAATGTTAAGCA
CTTTAGACATATAAAGCATGCATACGCATATTTACATACAGGATGTGTCTATTTATAATC
CGTCAAAGGATTAGCACCAACAAAGATAGAACGAGTCATTTAGGTTTAACGAGAATCATA
TTATGATTAAGTCATCTATCATGATCCTAATTAAAAATCAAATAAAAAAGTGATCAATTA
AATTAGTAAAGATAAAAGAAAAAATAAATAAACAAATATCAGGATTTACTAAAAAATTAA
AAAGGAAAGAAAATTAGTTTAACTTTTACTTTTTGATAATTTAATTTCTGGTACTTAGTT
ATTTTTAGAAATAAAAGAAAAAAATAATTAATTAATTTGCAAAAACATTTAAAAGAAATT
AAAAGTATTTATCATTTTTAAAAAAAATATAAAACATATTTTAGAAGTTATGGAGAATAA
AGCAGTTATTAATGTTTGTATTACAGGCGCTGCTGGTAATATTGCATACGCCTTGTATTC
TATATTGTGCACTGGCCAAATATTTGGGTCTAATCAAAAAATGAACTTAAAGCTTTTAGA
TATTGAATCTCAAGCAAAGGGTCTTTAAGGAGTTGCATTAGAATTAGAAGATTGCGCCTA
TGCCCTCGTTAATTCGATAGAGTACGGTTTTGACCCCGAAGTACTTTTCAAAGATATGGA
TGTTGGCATTTTCCTCGGAGGGTAATCAAGAAGACCTGGTATGGAAAGAGTTGATTTACT
TTAAGTAAATAACAGAATTTTCAAGATCTAGGGTAAAGCTTTGAATAAAGTAGCTAAGCC
AAGCACTAAGATTCTAGTAATCGCAAATCCAGTAAGAAAAAAAATATATTTTTATAGAAA
ACTTAGATAATTACCAACTTAATTATGCACGTTAGTTAAAGAATCAGATTGGTTAGTTTA
AGTATCAATTTGAAATGGTAGAGATAAAAATTTGATTGATTTGCTAATGTGCTGATTGAC
TAATAAGCAGTCAATCTATTTTGTTTATGACAAAATTGAAATACTTTTATAAGTTTTGAT
AATCTATTACAATTATGAATATCAACATTATTAATAAGCATTCAATTAATGTAAAAATAA
TCTTATTATCTGTTTTATAATAAAAAGGTAAACACAAATTGCTTAACTTTGATTCAAAAT
TGTCCTAACATTCCTAAAGAAAATTTCACTTGCTTGACAAGACTTGACCACAATAGAGCA
ATAGCATAATTAGCAATCAAAGCAAAAGTACCTGTTACCGAAGTTAAAAATGTTATTCTA
TGGGGTAATTAATTTAAATGTCAAAAATCAAGAGGAATTGGCATTCTATTTAAAGAATTT
TAATATCATTTTAATAATTTACATAGGTAACCATAGTTTAACTATGTATCCAGATCACAA
TCATGCACACATTGAAGGTCAACCAGCAGTAGATATATATGAAGAGGAATGGATTAAGAA
TACTTTCATTCCTAAAGTTTAAAAAAGGGGAGGAGAAGTTCTAAATTTGAGATAGAACTC
CTCAGTTATGAGTGCTGCAATTGCTATTCGTGACCACTTAGTTAATTGGATTTATGGAAC
TCCTGAAGGATAGTTCGTATCTATGGGTGTTTACACTGACGGAAGCTTCTATGATATTCC
CGCAGATTTTGTTTTCTCAGTTCCAGTTAAGTGCAAAGACTTTAAATACGAAGTTGTTAA
GGATTTGACTATTAGCTAGTTTTCAAGATAAAAAATTAACATCAGTTTGAGAGAATTGTA
AGATGAGAAAGAAGAAGCTAACTGCTACGACGATGATGCTGAAGACGAATCTGAAGAGTG
AAACAAGTGAGATTAGTTATCACAAAGCAGAAAGAAACAAGCAAATAGTATTATTTCAGC
AAATGTATCAAACTAAAATTTAGTAAAAATGTTGAAAAATACAAGCTTTTTCTCGCCTTC
TGCACTGAAACTACTCTTTCTTCTATCTATCATTATAAAACATATCTATCACCTATAACC
TTTATATTTCACTAGATCAATTAGCTTTAACATATAAATATCTAATTAAAATTTTAAATA
CATTGAAGCAAACAAATAAAAAATTAATAAATACACAAAACTTTAATAATTCATTGCTAA
ATATATTACTCAGTTGCTTAATTACTGCCTTTTTGTCTAATTTAATCAAATATCTTCACC
ATAGCCATTAATCTCACTAAAATAGCAAGTAAGCTTGCAAATATTGATGTTTATAATCCA
AAAAAATGCTGTTTATTGCTATTTAGTATTTAACTAAGATTATACACATTATTTTTCTAA
TTTTCACACACTAAAAATAAGAAATTATTACCTTACCATCAAAGACTTAAATCTTTAATG
TTGACAAATAAAAAAGCTTCTCTGAAAGAGAATAAAGTTAAAATAGCTTTACTGTAATTA
TTTAAAAACTATTAAAGTATACTAATAGCAAATTTGAATAAGATAAATAAATCAAACTAT
TTAATCATATAGAAGAAACTATTCAATTATCAATCAATTAGAAGATAAGTAATTAAGCAA
AAAAAATTACAAATTAATCATCAAAAATGTATATTTGCTTTTTGATGGTAAAGTAATTAA
TTAGTTGTACAATTTCCTAGTGGTATTAGACAAAGTTAGTATAGTAATATGGCATAAAAT
GTTATAAATAAATATAATAAATGTTTTAATTTTTGTTAATGTGCTATATATTTCATCAAT
ATCTCCAAA