Identifiers and Description

Gene Model Identifier

TTHERM_00052260

Standard Name

MDH3 (Malate dehydrogenase 3)

Aliases

PreTt11406 | 3.m01638 | 3824.m03161

Description

Malate dehydrogenase, cytoplasmic, putative

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 17.3%

TetraMine Data

TTHERM_00052260

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01541.19.997093137033517e-262malate dehydrogenase, cytoplas
mic (365 aa)
OxytrichaContig10720.0.g161.9996385480812013e-123lactate/malate dehydrogenase,
NAD binding domain
DictyBaseDDB_G02802551.0001155149984988e-113mdhC on chromosome: 3 position
3171359 to 3172577
WormBaseWBGene000184911.9999366565375063e-113locus:mdh-1 Malate dehydroge
nase status:Confirmed UniP
rot:Q9UAV5 protein_id:CCD713
16.1
Stentor CoeruleusSteCoe_239893.1743585474772134e-60
SGDYOL126C0.00000000000040012475857291343MDH2 Cytoplasmic malate dehydr
ogenase, one of three isozymes
that catalyze interconversion
of malate and oxaloacetate; i
nvolved in the glyoxylate cycl
e and gluconeogenesis during g
rowth on two-carbon compounds;
interacts with Pck1p and Fbp1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00052260(coding)
ATGTTCTCTAAATTTAGTTAATATTTTACAAAAAAGACTTTTGGTTATGGAAGTTTATCT
TTGTTGAGCTTAGTAGGAATCAACCACTAACTCTAAAAGAGTAAGACCACTGTTTATTCT
AAGGAAAATGATGAAATTAACGTATGTGTTACAGGAGCTGCTGGTCAAATTGGATATGCT
TTCTTACCTCTCCTTCTTACAGGATAATGCTTTGGAGATAAAAAAATAAATCTTCGTTTG
CTTGATGTTCCATAAGCAGAATCGATTTTGTAGGGAGTTGAGCTTGAACTTTAAGATGGA
GCTTACCCTCTCCTTAAAAGTATTAAAACTGGCTCTAATGAAAGTATATTGTTTTAAGAT
GTTGATGTAGCTGTCTTCATAGGAGGTTTCCCAAGAAAGCCAGGCATGGAAAGAAAAGAT
TTACTCACTATAAACGGAAATATTTTCAAGAAATAAGGTTAAGCTTTAGATACAGTTGCT
AAAAAAACCTGCAAATCTTTAGTAGTAGCCAATCCTGCCAACACAAACTGTCTCATTTTA
GCAGAAACTGCTAAGAGCATTCCAAAATAGAATTTCTCTGCATTGACAAGATTAGACCAC
AATAGAGCTATTAGTTAAATTGCTCTTAAAGCTGGCTGCTCAATAACTGATGTAAAAAAT
GTTATCATTTGGGGTAATCACTCAACAACTCAATATCCAGATGTAAATCATGGAACTGTC
TTAGGAAAGAGAATCAGATAATTTATTAACGATGAAGCCTATTTAAATAATGCATTTATT
GAAAGAGTGTAAAAAAGAGGTGGTGAAGTTCTTGCAGCTAGAAAAAATTCCTCTGTTATG
AGTGCTGCTAATGCTGTCAAAGATCACTTGCATGACTGGTATTTTGGAACTAAGTCAGGA
GAGTTTGTATCAATGGCTGTTTACTCAGATGGCTCATATGGTGTTCCAAAAGGACTCATT
TTTTCTTATCCAGTAACTTGTTCTAACTTTAACTATAAGATCGTATAAGGATTAAACATT
GATGAATTCTCTAAAGAGAAGATAAGAATTACAACTGAAGAACTTCTTTCAGAAAAGGCT
GATGCATTTTCTGCTTGA


>TTHERM_00052260(protein)
MFSKFSQYFTKKTFGYGSLSLLSLVGINHQLQKSKTTVYSKENDEINVCVTGAAGQIGYA
FLPLLLTGQCFGDKKINLRLLDVPQAESILQGVELELQDGAYPLLKSIKTGSNESILFQD
VDVAVFIGGFPRKPGMERKDLLTINGNIFKKQGQALDTVAKKTCKSLVVANPANTNCLIL
AETAKSIPKQNFSALTRLDHNRAISQIALKAGCSITDVKNVIIWGNHSTTQYPDVNHGTV
LGKRIRQFINDEAYLNNAFIERVQKRGGEVLAARKNSSVMSAANAVKDHLHDWYFGTKSG
EFVSMAVYSDGSYGVPKGLIFSYPVTCSNFNYKIVQGLNIDEFSKEKIRITTEELLSEKA
DAFSA


>TTHERM_00052260(gene)
ATGTTCTCTAAATTTAGTTAATATTTTACAAAAAAGACTTTTGGTTATGGAAGTTTATCT
TTGTTGAGCTTAGTAGGAATCAACCACTAACTCTAAAAGAGTAAGACCACTGTTTATTCT
AAGGAAAATGATGAAATTAACGTATGTGTTACAGGAGCTGCTGGTCAAATTGGATATGCT
TTCTTACCTCTCCTTCTTACAGGATAATGCTTTGGAGATAAAAAAATAAATCTTCGTTTG
CTTGATGTTCCATAAGCAGAATCGATTTTGTAGGGAGTTGAGCTTGAACTTTAAGATGGA
GCTTACCCTCTCCTTAAAAGTATTAAAACTGGCTCTAATGAAAGTATATTGTTTTAAGAT
GTTGATGTAGCTGTCTTCATAGGAGGTTTCCCAAGAAAGCCAGGCATGGAAAGAAAAGAT
TTACTCACTATAAACGGAAATATTTTCAAGAAATAAGGTTAAGCTTTAGATACAGTTGCT
AAAAAAACCTGCAAATCTTTAGTAGTAGCCAATCCTGCCAACACAAACTGTCTCATTTTA
GCAGAAACTGCTAAGAGCATTCCAAAATAGAATTTCTCTGCATTGACAAGATTAGACCAC
AATAGAGCTATTAGTTAAATTGCTCTTAAAGCTGGCTGCTCAATAACTGATGTAAAAAAT
GTTATCATTTGGGGTAATCACTCAACAACTCAATATCCAGATGTAAATCATGGAACTGTC
TTAGGTAAAAATTACAATTATATAAACAGCTTACAATTAAATTAATTAAAAAGATTTCAT
ATACATAAAATAAAAAACTAACTTATTCCAAAATACAAGATAGATAATATCAATATTTGA
GAGAGAATATGAGTTAATGTATGTTTATCAAAATCTTATTTTCAAATAATAAGTATGATA
ATTTTTTAAAAAATAAATTTTATAAAAAAGGAAAGAGAATCAGATAATTTATTAACGATG
AAGCCTATTTAAATAATGCATTTATTGAAAGAGTGTAAAAAAGAGGTGGTGAAGTTCTTG
CAGCTAGAAAAAATTCCTCTGTTATGAGTGCTGCTAATGCTGTCAAAGATCACTTGCATG
ACTGGTATTTTGGAACTAAGTCAGGAGAGTTTGTATCAATGGCTGTTTACTCAGATGGCT
CATATGGTGTTCCAAAAGGACTCATTTTTTCTTATCCAGTAACTTGTTCTAACTTTAACT
ATAAGATCGTATAAGGATTAAACATTGATGAATTCTCTAAAGAGAAGATAAGAATTACAA
CTGAAGAACTTCTTTCAGAAAAGGCTGATGCATTTTCTGCTTGA