Identifiers and Description

Gene Model Identifier

TTHERM_00237500

Standard Name

MDH2 (malate dehydrogenase 2)

Aliases

PreTt18794 | 20.m00258 | 3706.m00025

Description

malate dehydrogenase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( TIGR01759 ) malate dehydrogenase
  • ( TIGR01756 ) lactate dehydrogenase
  • ( TIGR01758 ) malate dehydrogenase, NAD-dependent
  • ( TIGR01763 ) malate dehydrogenase, NAD-dependent
  • ( TIGR01772 ) malate dehydrogenase, NAD-dependent
  • ( TIGR01757 ) malate dehydrogenase, NADP-dependent
  • ( PF00056 ) lactate/malate dehydrogenase, NAD binding domain
  • ( PF02866 ) lactate/malate dehydrogenase, alpha/beta C-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00237500

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07942.19.997093137033517e-262malate dehydrogenase (355 aa)
OxytrichaContig10720.0.g168.001645293484705e-131lactate/malate dehydrogenase,
NAD binding domain
DictyBaseDDB_G02902071.9996385480812013e-123mdhA on chromosome: 5 position
3795307 to 3796614
WormBaseWBGene000184915.001313616964319e-114locus:mdh-1 Malate dehydroge
nase status:Confirmed UniP
rot:Q9UAV5 protein_id:CCD713
16.1
Stentor CoeruleusSteCoe_188802.506567475899953e-46

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00237500(coding)
ATGGATAGAATTCATACCCTTGGAAGACACATGTGTCCTAACAAGCAACTTAAATAGCCA
ATTAAGGTTACTGTTACAGGAGCAGCAGGTAATATTGGTTATGCTTTTGTATTCTTTGCA
GGTTAAGGTCGTCTTTTTGGACAAGATCAGCCAATAGACCTTACTCTTCTAGAACTTCCT
AACTCTAAGAGACCTATGATGGGAACAGTCATGGAATTGGATGATTGTGCCTATCCTCTT
TTAGCAAACATAAGAACAACTACAAGTATAGATGAGGCTTTTGTTGGCTGCTAAGTAGCC
GTCCTTGTAGGTGCAAAACCCAGAGGCCCAGGCATGGAAAGAAAAGATTTATTAAGCGAA
AATGGAAAGATTTTCAAAGCTCAAGGTGAAGCAATAGATAGGTATGCAGACAGAGATTGC
AAAGTTTTAGTTGTAGGTAATCCTGCAAATACTAACTGCTTAATAGTTTAAAGATATGCC
CCTTCAATTCCTAAATAAAATTTCACAGCTATGACTCGTCTTGACCAAAATAGAGCTGAT
TCTATCTTAGCTTCAAAAATTGGAGTCCATTCAAGATAAATTCGTAATCTGATTATTTGG
GGCAACCATTCTGCTACTCAAGTGCCAGATGCTTCATAAGGAATAATCATGAATTATCCT
TAACCTGGTATGGTAACAGCTGCTAGAGGAGCTGTGAGCAACGATAAGTGGTTGACTACA
GAATTCGTTGAAACTGTAGCAAAAAGAGGTGCAGCTATCATATAGATGAGAGAAAAATCA
TCTGCTGCATCAGCAGCTAGTGCAGCCTGTGATCATATTCATGATTGGTTTATTGGAACC
CAAAGTGGTTAAATTGTTTCAATGGCAGTAATCAGTGATGGTTCTTACGGTGTCCCTGAA
GGCTTATGCTTTTCATATCCAGTAACATGCCAAAATGGTAAATGGCAAATAGTACAAGGT
CTTTAATGGGATGAGTTAACTAAAAAGAGAATCGAAGTAACAACAAAGGAGCTTATTGAA
GAACGTGATTTAGCACTTTAATCTTTAGCTGCCAACACAAAATGA


>TTHERM_00237500(protein)
MDRIHTLGRHMCPNKQLKQPIKVTVTGAAGNIGYAFVFFAGQGRLFGQDQPIDLTLLELP
NSKRPMMGTVMELDDCAYPLLANIRTTTSIDEAFVGCQVAVLVGAKPRGPGMERKDLLSE
NGKIFKAQGEAIDRYADRDCKVLVVGNPANTNCLIVQRYAPSIPKQNFTAMTRLDQNRAD
SILASKIGVHSRQIRNLIIWGNHSATQVPDASQGIIMNYPQPGMVTAARGAVSNDKWLTT
EFVETVAKRGAAIIQMREKSSAASAASAACDHIHDWFIGTQSGQIVSMAVISDGSYGVPE
GLCFSYPVTCQNGKWQIVQGLQWDELTKKRIEVTTKELIEERDLALQSLAANTK


>TTHERM_00237500(gene)
ATGGATAGAATTCATACCCTTGGAAGACACATGTGTCCTAACAAGCAACTTAAATAGCCA
ATTAAGGTTACTGTTACAGGAGCAGCAGGTAATATTGGTTATGCTTTTGTATTCTTTGCA
GGTTAAGGTCGTCTTTTTGGACAAGATCAGCCAATAGACCTTACTCTTCTAGAACTTCCT
AACTCTAAGAGACCTATGATGGGAACAGTCATGGAATTGGATGATTGTGCCTATCCTCTT
TTAGCAAACATAAGAACAACTACAAGTATAGATGAGGCTTTTGTTGGCTGCTAAGTAGCC
GTCCTTGTAGGTGCAAAACCCAGAGGCCCAGGCATGGAAAGAAAAGATTTATTAAGCGAA
AATGGAAAGATTTTCAAAGCTCAAGGTGAAGCAATAGATAGGTATGCAGACAGAGATTGC
AAAGTTTTAGTTGTAGGTAATCCTGCAAATACTAACTGCTTAATAGTTTAAAGATATGCC
CCTTCAATTCCTAAATAAAATTTCACAGCTATGACTCGTCTTGACCAAAATAGAGCTGAT
TCTATCTTAGCTTCAAAAATTGGAGTCCATTCAAGATAAATTCGTAATCTGATTATTTGG
GGCAACCATTCTGCTACTCAAGTGCCAGATGCTTCATAAGGAATAATCATGAATTATCCT
TAACCTGGTATGGTAACAGCTGCTAGAGGAGCTGTGAGCAACGATAAGTGGTTGACTACA
GAATTCGTTGAAACTGTAGCAAAAAGAGGTGCAGCTATCATATAGATGAGAGAAAAATCA
TCTGCTGCATCAGCAGCTAGTGCAGCCTGTGATCATATTCATGATTGGTTTATTGGAACC
CAAAGTGGTTAAATTGTTTCAATGGCAGTAATCAGTGATGGTTCTTACGGTGTCCCTGAA
GGCTTATGCTTTTCATATCCAGTAACATGCCAAAATGGTAAATGGCAAATAGTACAAGGT
CTTTAATGGGATGAGTTAACTAAAAAGAGAATCGAAGTAACAACAAAGGAGCTTATTGAA
GAACGTGATTTAGCACTTTAATCTTTAGCTGCCAACACAAAATGA