Identifiers and Description

Gene Model Identifier

TTHERM_00030190

Standard Name

MDH1 (malate dehydrogenase 1)

Aliases

PreTt14250 | 2.m02347 | 3825.m02637

Description

malate dehydrogenase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00030190

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00809.19.997093137033517e-262malate dehydrogenase (348 aa)
OxytrichaContig22377.0.g624.9990774786573115e-144lactate/malate dehydrogenase,
alpha/beta C-terminal domain
DictyBaseDDB_G02926001.999489510516749e-128mdhB on chromosome: 6 position
1826095 to 1827141
WormBaseWBGene000184912.998957050488393e-103locus:mdh-1 Malate dehydroge
nase status:Confirmed UniP
rot:Q9UAV5 protein_id:CCD713
16.1
Stentor CoeruleusSteCoe_53989.462629465836378e-57
SGDYKL085W0.000000019990673443141236MDH1 Mitochondrial malate dehy
drogenase, catalyzes interconv
ersion of malate and oxaloacet
ate; involved in the tricarbox
ylic acid (TCA) cycle; phospho
rylated

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000168

Sequences

>TTHERM_00030190(coding)
ATGATCTCTAAGCTCTTCTAAAATACTGCTAAGTCCCTCACTGCTGTCAACAGCGCTTCC
TTCAGTCACCACCACCACAAGGCTCCCGTCAGAGTTGCTGTCACTGGTGCTGCTGGTAAC
ATCGGTTATGCTCTCGTCTTCAGAATTGCTTCTGGTGAATTATTAGGTAAGGACCAACCC
GTCATCCTTTAATTAATCGAACTCCCCCATGCTTAAAATGCTCTTAAGGGTGTTGCTATG
GAATTGAACGATTGTGCTTTCCCCTTGTTACGTGACATCGTCACCACTGACAGCCAATCT
GTTGGTTTCAAGAATGCTGACTACGCTTTGTTGGTTGGTTCTAAGCCCAGAGGTAAAGGT
CAAGAAAGAGCTGATCTTATCAAGGATAATGGTAAGATTTTCGTCGACACTGGTAAGGCT
ATTAACGACAATGCCTCCAGAGACTGCAAGGTTTTGGTTGTTGGTAACCCCGCTAACACT
AACTGTTTAATCGCTGCTCACTATGCTAAGGATATCCCTAAAGAAAACTTCACTGCCATG
ACCAGATTAGATCACGACCGTGCCTTATACTAACTCGCCTCCAAGACTGGATCTTAAGTC
ACTGACATTAAAAAGCTCTGCATCTGGGGTAACCACTCTCCTACCATGTATCCCGATTTG
ACCAACACCACCGTTCACAATAAGCTTGTTGCTCCCACTTTGGACCATGCTTGGATTGAT
ACTTTCTTCAATCCTAAGGTTGGTAAGAGAGGTGCTGAAATTATTGATGCCAGAGGTTCT
TCTTCTGCTGCTTCTGCTGCCAACGCTGCTATTAACCACGTTAGAGACTGGGCTTTGGGT
AGTGAAGATTGGGTTTCTATGGGTGTTCCCTCTGATGGTTCTTACAACGTTCCCAAGGGT
TTGGTCTTCTCCTTCCCCGTCACCACCAAGAACGGTAAGTACTCCATCGTTCAAGGTCTT
AAGATTAGTGAATACTCTCAAAAGAAGATTGATATCACTACTAAGGAACTTCTTGAAGAA
AGAGCTTGCGTTGAACACTTACTCAAGTGA


>TTHERM_00030190(protein)
MISKLFQNTAKSLTAVNSASFSHHHHKAPVRVAVTGAAGNIGYALVFRIASGELLGKDQP
VILQLIELPHAQNALKGVAMELNDCAFPLLRDIVTTDSQSVGFKNADYALLVGSKPRGKG
QERADLIKDNGKIFVDTGKAINDNASRDCKVLVVGNPANTNCLIAAHYAKDIPKENFTAM
TRLDHDRALYQLASKTGSQVTDIKKLCIWGNHSPTMYPDLTNTTVHNKLVAPTLDHAWID
TFFNPKVGKRGAEIIDARGSSSAASAANAAINHVRDWALGSEDWVSMGVPSDGSYNVPKG
LVFSFPVTTKNGKYSIVQGLKISEYSQKKIDITTKELLEERACVEHLLK


>TTHERM_00030190(gene)
ATGATCTCTAAGCTCTTCTAAAATACTGCTAAGTCCCTCACTGCTGTCAACAGCGCTTCC
TTCAGTCACGTAATTTAACACTATCCCTTATCTATTAACCCACTCACATTGAATTGAAAG
ACTTTTTCATCCAATTAAAGCATAAATATCCATTTTAGCTTTAACAACCATATTTTAATT
TGTAAAATGCTAATTAACTCATTTCTTAAATAAAACTTTAGCACCACCACAAGGCTCCCG
TCAGAGTTGCTGTCACTGGTGCTGCTGGTAACATCGGTTATGCTCTCGTCTTCAGAATTG
CTTCTGGTGAATTATTAGGTAAGGACCAACCCGTCATCCTTTAATTAATCGAACTCCCCC
ATGCTTAAAATGCTCTTAAGGTAAACAAAACAACTTCTTTCAGCTTTGATACTTTATTTA
TAAGCAGCTTAAATGTATAAAGTAGTTGCTTTCTACTCTATTTATTAGAGTATATGAAGC
TTATTTTATTCTGAACAAAAGCTGGATTTATTTGATTATATTTATTCTATATACTAGTTT
AACAATACTTTGTTTTAAATTTAAAGGGTGTTGCTATGGAATTGAACGATTGTGCTTTCC
CCTTGTTACGTGACATCGTCACCACTGACAGCCAATCTGTTGGTTTCAAGAATGCTGACT
ACGCTTTGTTGGTTGGTTCTAAGCCCAGAGGTAAAGGTCAAGAAAGAGCTGATCTTATCA
AGGATAATGGTAAGATTTTCGTCGACACTGGTAAGGTAAGGATAAAACTTTTAAAGATAT
TTTATTAGTACGATAAGGAATAAATGAATAATGAGTAGAAAAGAAATTTCATATAAAATT
TAAGAGTTGTTAGTAGAACATTCAGCATTAATAAAAGCTTTATCAAAATAAGCTTTCGCT
TGTTTAGCAGAAATAATAAATTAATAGGAATAAAAAATTTATATCTAGAAATATACTCAA
ACATATCAATAAATAAAGCAAATAACACAAATAGAATAATCTCGTTTTTTCTATTAATTT
ATTTCTTGGTTCTCCTACTACTTGTTATTCAAATATTACCTTAAATTAATTTTTAAAAAT
CTAATAGCTAGAAGCGAATTAATTTTATTTGTTTTTTAATAGGCTATTAACGACAATGCC
TCCAGAGACTGCAAGGTTTTGGTTGTTGGTAACCCCGCTAACACTAACTGTTTAATCGCT
GCTCACTATGCTAAGGATATCCCTAAAGAAAACTTCACTGCCATGACCAGATTAGATCAC
GACCGTGCCTTATACTAACTCGCCTCCAAGACTGGATCTTAAGTCACTGACATTAAAAAG
CTCTGCATCTGGGGTAACCACTCTCCTACCATGTATCCCGATTTGACCAACACCACCGTT
CACAATAAGCTTGTTGCTCCCACTTTGGACCATGCTTGGATTGATACTTTCTTCAATCCT
AAGGTTGGTAAGAGAGGTGCTGAAATTATTGATGCCAGAGGTTCTTCTTCTGCTGCTTCT
GCTGCCAACGCTGCTATTAACCACGTTAGAGACTGGGCTTTGGGTAGTGAAGATTGGGTT
TCTATGGGTGTTCCCTCTGATGGTTCTTACAACGTTCCCAAGGGTTTGGTCTTCTCCTTC
CCCGTCACCACCAAGAACGGTAAGTACTCCATCGTTCAAGGTCTTAAGATTAGTGAATAC
TCTCAAAAGAAGATTGATATCACTACTAAGGAACTTCTTGAAGAAAGAGCTTGCGTTGAA
CACTTACTCAAGTGA