Identifiers and Description

Gene Model Identifier

TTHERM_00030190

Standard Name

MDH1 (Malate DeHydrogenase 1)

Aliases

PreTt14250 | 2.m02347 | 3825.m02637

Description

Malate dehydrogenase family protein; converts malate to oxaloacetate in TCA cycle

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.2%

TetraMine Data

TTHERM_00030190

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00809.19.997093137033517e-262malate dehydrogenase (348 aa)
OxytrichaContig22377.0.g624.9990774786573115e-144lactate/malate dehydrogenase,
alpha/beta C-terminal domain
DictyBaseDDB_G02926001.999489510516749e-128mdhB on chromosome: 6 position
1826095 to 1827141
WormBaseWBGene000184912.998957050488393e-103locus:mdh-1 Malate dehydroge
nase status:Confirmed UniP
rot:Q9UAV5 protein_id:CCD713
16.1
Stentor CoeruleusSteCoe_53989.462629465836378e-57
SGDYKL085W0.000000019990673443141236MDH1 Mitochondrial malate dehy
drogenase, catalyzes interconv
ersion of malate and oxaloacet
ate; involved in the tricarbox
ylic acid (TCA) cycle; phospho
rylated

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000224
  2. Ref:SUPR000168

Sequences

>TTHERM_00030190(coding)
ATGATCTCTAAGCTCTTCTAAAATACTGCTAAGTCCCTCACTGCTGTCAACAGCGCTTCC
TTCAGTCACCACCACCACAAGGCTCCCGTCAGAGTTGCTGTCACTGGTGCTGCTGGTAAC
ATCGGTTATGCTCTCGTCTTCAGAATTGCTTCTGGTGAATTATTAGGTAAGGACCAACCC
GTCATCCTTTAATTAATCGAACTCCCCCATGCTTAAAATGCTCTTAAGGGTGTTGCTATG
GAATTGAACGATTGTGCTTTCCCCTTGTTACGTGACATCGTCACCACTGACAGCCAATCT
GTTGGTTTCAAGAATGCTGACTACGCTTTGTTGGTTGGTTCTAAGCCCAGAGGTAAAGGT
CAAGAAAGAGCTGATCTTATCAAGGATAATGGTAAGATTTTCGTCGACACTGGTAAGGCT
ATTAACGACAATGCCTCCAGAGACTGCAAGGTTTTGGTTGTTGGTAACCCCGCTAACACT
AACTGTTTAATCGCTGCTCACTATGCTAAGGATATCCCTAAAGAAAACTTCACTGCCATG
ACCAGATTAGATCACGACCGTGCCTTATACTAACTCGCCTCCAAGACTGGATCTTAAGTC
ACTGACATTAAAAAGCTCTGCATCTGGGGTAACCACTCTCCTACCATGTATCCCGATTTG
ACCAACACCACCGTTCACAATAAGCTTGTTGCTCCCACTTTGGACCATGCTTGGATTGAT
ACTTTCTTCAATCCTAAGGTTGGTAAGAGAGGTGCTGAAATTATTGATGCCAGAGGTTCT
TCTTCTGCTGCTTCTGCTGCCAACGCTGCTATTAACCACGTTAGAGACTGGGCTTTGGGT
AGTGAAGATTGGGTTTCTATGGGTGTTCCCTCTGATGGTTCTTACAACGTTCCCAAGGGT
TTGGTCTTCTCCTTCCCCGTCACCACCAAGAACGGTAAGTACTCCATCGTTCAAGGTCTT
AAGATTAGTGAATACTCTCAAAAGAAGATTGATATCACTACTAAGGAACTTCTTGAAGAA
AGAGCTTGCGTTGAACACTTACTCAAGTGA


>TTHERM_00030190(protein)
MISKLFQNTAKSLTAVNSASFSHHHHKAPVRVAVTGAAGNIGYALVFRIASGELLGKDQP
VILQLIELPHAQNALKGVAMELNDCAFPLLRDIVTTDSQSVGFKNADYALLVGSKPRGKG
QERADLIKDNGKIFVDTGKAINDNASRDCKVLVVGNPANTNCLIAAHYAKDIPKENFTAM
TRLDHDRALYQLASKTGSQVTDIKKLCIWGNHSPTMYPDLTNTTVHNKLVAPTLDHAWID
TFFNPKVGKRGAEIIDARGSSSAASAANAAINHVRDWALGSEDWVSMGVPSDGSYNVPKG
LVFSFPVTTKNGKYSIVQGLKISEYSQKKIDITTKELLEERACVEHLLK


>TTHERM_00030190(gene)
ATGATCTCTAAGCTCTTCTAAAATACTGCTAAGTCCCTCACTGCTGTCAACAGCGCTTCC
TTCAGTCACGTAATTTAACACTATCCCTTATCTATTAACCCACTCACATTGAATTGAAAG
ACTTTTTCATCCAATTAAAGCATAAATATCCATTTTAGCTTTAACAACCATATTTTAATT
TGTAAAATGCTAATTAACTCATTTCTTAAATAAAACTTTAGCACCACCACAAGGCTCCCG
TCAGAGTTGCTGTCACTGGTGCTGCTGGTAACATCGGTTATGCTCTCGTCTTCAGAATTG
CTTCTGGTGAATTATTAGGTAAGGACCAACCCGTCATCCTTTAATTAATCGAACTCCCCC
ATGCTTAAAATGCTCTTAAGGTAAACAAAACAACTTCTTTCAGCTTTGATACTTTATTTA
TAAGCAGCTTAAATGTATAAAGTAGTTGCTTTCTACTCTATTTATTAGAGTATATGAAGC
TTATTTTATTCTGAACAAAAGCTGGATTTATTTGATTATATTTATTCTATATACTAGTTT
AACAATACTTTGTTTTAAATTTAAAGGGTGTTGCTATGGAATTGAACGATTGTGCTTTCC
CCTTGTTACGTGACATCGTCACCACTGACAGCCAATCTGTTGGTTTCAAGAATGCTGACT
ACGCTTTGTTGGTTGGTTCTAAGCCCAGAGGTAAAGGTCAAGAAAGAGCTGATCTTATCA
AGGATAATGGTAAGATTTTCGTCGACACTGGTAAGGTAAGGATAAAACTTTTAAAGATAT
TTTATTAGTACGATAAGGAATAAATGAATAATGAGTAGAAAAGAAATTTCATATAAAATT
TAAGAGTTGTTAGTAGAACATTCAGCATTAATAAAAGCTTTATCAAAATAAGCTTTCGCT
TGTTTAGCAGAAATAATAAATTAATAGGAATAAAAAATTTATATCTAGAAATATACTCAA
ACATATCAATAAATAAAGCAAATAACACAAATAGAATAATCTCGTTTTTTCTATTAATTT
ATTTCTTGGTTCTCCTACTACTTGTTATTCAAATATTACCTTAAATTAATTTTTAAAAAT
CTAATAGCTAGAAGCGAATTAATTTTATTTGTTTTTTAATAGGCTATTAACGACAATGCC
TCCAGAGACTGCAAGGTTTTGGTTGTTGGTAACCCCGCTAACACTAACTGTTTAATCGCT
GCTCACTATGCTAAGGATATCCCTAAAGAAAACTTCACTGCCATGACCAGATTAGATCAC
GACCGTGCCTTATACTAACTCGCCTCCAAGACTGGATCTTAAGTCACTGACATTAAAAAG
CTCTGCATCTGGGGTAACCACTCTCCTACCATGTATCCCGATTTGACCAACACCACCGTT
CACAATAAGCTTGTTGCTCCCACTTTGGACCATGCTTGGATTGATACTTTCTTCAATCCT
AAGGTTGGTAAGAGAGGTGCTGAAATTATTGATGCCAGAGGTTCTTCTTCTGCTGCTTCT
GCTGCCAACGCTGCTATTAACCACGTTAGAGACTGGGCTTTGGGTAGTGAAGATTGGGTT
TCTATGGGTGTTCCCTCTGATGGTTCTTACAACGTTCCCAAGGGTTTGGTCTTCTCCTTC
CCCGTCACCACCAAGAACGGTAAGTACTCCATCGTTCAAGGTCTTAAGATTAGTGAATAC
TCTCAAAAGAAGATTGATATCACTACTAAGGAACTTCTTGAAGAAAGAGCTTGCGTTGAA
CACTTACTCAAGTGA