Identifiers and Description

Gene Model Identifier

TTHERM_01207610

Standard Name

MCMD1 (MCM Domain1)

Aliases

PreTt09115 | 274.m00032

Description

Meiosis-specific MCM family protein; required for homologous recombination in meiosis; interacts with Pamd1.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00493 ) MCM2/3/5 family
  • ( PF05316 ) Mitochondrial ribosomal protein (VAR1)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.8%

TetraMine Data

TTHERM_01207610

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20942.19.997093137033517e-262hypothetical protein (779 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01207610(coding)
ATGAGTTTTTAGAATAAAAATAAACCAAATACATCGAGCAGCTTTTTTAACAATAATTCA
TTTTTTAGAGGAATTAAAATTGATGAAGCAACATAGTTGAATCTGAGTATATCTTAAATT
CCTTCTTAAATGGGATAATCTTGCATGCTCAGCTAGGACTTATTTCTTTCATAAAAACCT
TAAGATAAGTCAAAAAACAAAGACTTTAAACAGATGCAATCAGATTCTTCAAAAATTTCA
TTTACTAAAGACTTAACTTCCAGTTTTGTTAGCAATTCTAATAACAATGCTTTTTCTATT
AAAATAGATGCTAGCTCTATTGATGAGCAATTAAGTTCAGGAGATTACTAAAAAGTTAAA
GAATTCGTTTATTATTTCTAAAATCTTCTTGTTTGCAAAGACCACAAAAATTCTTTTGTT
TAAATAGATGATAATATTGTTTAGATTAATTTAGAAGAACTTTTATTCAACTAAAAATGT
TAAAATTCAACCTGTTTGGAAATTTGTAAGAAATAATTAAAAATAAGCTCTATTTATTCA
TTTAACAAACTGATGTACCACTCATTAAAAATTGCTTTAAATTCAGTTTTTTCTAAAAAT
TTAAAACCTGACTTTTCAAAATTAAAATTTCAATTGAAAGTAAGTCAAAACTTATAAAAT
AGTGAGGGTGAGTCTATCTATAAAGCTAAGCATAACGACTTAGTTTTTTTGTAGGGTTTT
TTTGAGAGCTATCTAGATTCAAATATTTATTTTTCTTATGTTTAAAGGAGATATACTATT
GTCCATTCTTACAAATTTATAGTTAACGATGAAAATTAAACATGCTTAACAGTATTTACA
CTTGAAAAAGAAGTAAAAGATAAAATTGATTTATTTTAGGATGTAAATTTAATTGGATTT
CTTGTGATTATCACTAACCCATTTAGTTAATTAAATGAGTTTACAATAGAAATAAACTAA
ATTAATTAAATTAAAGAAAATAATACTTAAGATTGTTTAGAAAATTAGCTAAAAATGATT
TAAGAAGTGAGAGAATTGTAATAGTAAAAATCATGCTTTGACTCAATGGTTAAAAATTTT
TTCAAAAATGTATTACCCCAAAATTTTGTGTTCAAAGGATTACTTTTGCTTATCCTAGTT
TCAAACACTTCTAAATTAACTGATTTAAATATTTTATTTCTATGTGATAATGGCTTATCT
TAAACAGATTTACTGAAGCAGCTGTAGCTTTTCCAGAAATAGAATTATAAAATAGTTTCA
GAATAAGAAAATAGAGCAAACAAGCAGCAAAGAAACACTATTATTTAGAAAAAAGTTAAT
GCTAAAAATAACTGCTTTATGAACTCTTCTAGCTAACCCAAAAAAGTTTATTTAAACTGT
CATAAATAAAATTCAGATGTTCTAAGAAGAAATTTAAAGTATAAATTTCACAGTGTTATT
ATGAAAGGTTAAATTGATAAATTGAGTGAATACCACTAAATAAATATGCTTTTTTCAAAC
TGTTGTTTCAGTAGTTACAACCAAAACTTGACTATATCTGAGAATTGCTTACCTTTGGGT
TCATCTTTACTTTAGGAGTTATAATATATATGCAGAATTAGAGACTGTGTTGACGAAGAT
TTTATTTAAAAAAAAATAAATGCACAATTGAATAGAAAAATATTATCAAAGAGAAAATTG
AATGATTACAATTGCGACGAATATTTTTAAGACTCTATTTCCTCTCGAATTAATCTATAA
GGCGAATGCTCTTACCAAGATGATAATTTTTATCAAAATTACTTTGAATTTCTTAAATAA
GTTCCAACTCCTTAATTTAATTAGAATTCATCTGAATTAGTGCGTTAAGCTTTTATAAAT
TTTCAGGTAGTAAACAAATTTTAGGAGAATCTTCACTTTTTGACATAAAATCCTAAAATT
GTTCCTTTTATTATAGAATTATCTAAAGCAAGAGCTAAAATTGATTTCTGTGAAATAGTA
AAAGAAGAACATATACAAGATGTAATAGATTTATTAATTGAAGGATTTTAAGAAATTTCT
TAAGAAGCAGAGTTAGTGTTCTAACAAGATGATGAAGAATAGCAACTCATGCAAGAAAAT
AATGAAGAAGTAACAGGTAGAAAAATTAAGAGATGTGGTAAATAAAAGCAAGTAATGATT
TATTTAAATTTTTTGAAGGAGAGAGGGAGTACCTTTAATAGAAGAGAATTAAGACAGTAT
TTTGAAGAGTGTGGAATTCAAATTACAGGTTGCTTTGATGATTTTATAGATGAATTAAAC
TATAATGATTACTTGAAATAAATTACACAAACTTAATTTTAGCTTAACTTAGATAAGCTA
TGA


>TTHERM_01207610(protein)
MSFQNKNKPNTSSSFFNNNSFFRGIKIDEATQLNLSISQIPSQMGQSCMLSQDLFLSQKP
QDKSKNKDFKQMQSDSSKISFTKDLTSSFVSNSNNNAFSIKIDASSIDEQLSSGDYQKVK
EFVYYFQNLLVCKDHKNSFVQIDDNIVQINLEELLFNQKCQNSTCLEICKKQLKISSIYS
FNKLMYHSLKIALNSVFSKNLKPDFSKLKFQLKVSQNLQNSEGESIYKAKHNDLVFLQGF
FESYLDSNIYFSYVQRRYTIVHSYKFIVNDENQTCLTVFTLEKEVKDKIDLFQDVNLIGF
LVIITNPFSQLNEFTIEINQINQIKENNTQDCLENQLKMIQEVRELQQQKSCFDSMVKNF
FKNVLPQNFVFKGLLLLILVSNTSKLTDLNILFLCDNGLSQTDLLKQLQLFQKQNYKIVS
EQENRANKQQRNTIIQKKVNAKNNCFMNSSSQPKKVYLNCHKQNSDVLRRNLKYKFHSVI
MKGQIDKLSEYHQINMLFSNCCFSSYNQNLTISENCLPLGSSLLQELQYICRIRDCVDED
FIQKKINAQLNRKILSKRKLNDYNCDEYFQDSISSRINLQGECSYQDDNFYQNYFEFLKQ
VPTPQFNQNSSELVRQAFINFQVVNKFQENLHFLTQNPKIVPFIIELSKARAKIDFCEIV
KEEHIQDVIDLLIEGFQEISQEAELVFQQDDEEQQLMQENNEEVTGRKIKRCGKQKQVMI
YLNFLKERGSTFNRRELRQYFEECGIQITGCFDDFIDELNYNDYLKQITQTQFQLNLDKL


>TTHERM_01207610(gene)
ATGAGTTTTTAGAATAAAAATAAACCAAATACATCGAGCAGCTTTTTTAACAATAATTCA
TTTTTTAGAGGAATTAAAATTGATGAAGCAACATAGTTGAATCTGAGTATATCTTAAATT
CCTTCTTAAATGGGATAATCTTGCATGCTCAGCTAGGACTTATTTCTTTCATAAAAACCT
TAAGATAAGTCAAAAAACAAAGACTTTAAACAGATGCAATCAGATTCTTCAAAAATTTCA
TTTACTAAAGACTTAACTTCCAGTTTTGTTAGCAATTCTAATAACAATGCTTTTTCTATT
AAAATAGATGCTAGCTCTATTGATGAGCAATTAAGTTCAGGAGATTACTAAAAAGTTAAA
GAATTCGTTTATTATTTCTAAAATCTTCTTGTTTGCAAAGACCACAAAAATTCTTTTGTT
TAAATAGATGATAATATTGTTTAGATTAATTTAGAAGAACTTTTATTCAACTAAAAATGT
TAAAATTCAACCTGTTTGGAAATTTGTAAGAAATAATTAAAAATAAGCTCTATTTATTCA
TTTAACAAACTGATGTACCACTCATTAAAAATTGCTTTAAATTCAGTTTTTTCTAAAAAT
TTAAAACCTGACTTTTCAAAATTAAAATTTCAATTGAAAGTAAGTCAAAACTTATAAAAT
AGTGAGGGTGAGTCTATCTATAAAGCTAAGCATAACGACTTAGTTTTTTTGTAGGGTTTT
TTTGAGAGCTATCTAGATTCAAATATTTATTTTTCTTATGTTTAAAGGAGATATACTATT
GTCCATTCTTACAAATTTATAGTTAACGATGAAAATTAAACATGCTTAACAGTATTTACA
CTTGAAAAAGAAGTAAAAGATAAAATTGATTTATTTTAGGATGTAAATTTAATTGGATTT
CTTGTGATTATCACTAACCCATTTAGTTAATTAAATGAGTTTACAATAGAAATAAACTAA
ATTAATTAAATTAAAGAAAATAATACTTAAGATTGTTTAGAAAATTAGCTAAAAATGATT
TAAGAAGTGAGAGAATTGTAATAGTAAAAATCATGCTTTGACTCAATGGTTAAAAATTTT
TTCAAAAATGTATTACCCCAAAATTTTGTGTTCAAAGGATTACTTTTGCTTATCCTAGTT
TCAAACACTTCTAAATTAACTGATTTAAATATTTTATTTCTATGTGATAATGGCTTATCT
TAAACAGATTTACTGAAGCAGCTGTAGCTTTTCCAGAAATAGAATTATAAAATAGTTTCA
GGTAATTTAGATTTTCTTAGAGTAAAAATATTTAACTTTTGAAATTAAAGAATAAGAAAA
TAGAGCAAACAAGCAGCAAAGAAACACTATTATTTAGAAAAAAGTTAATGCTAAAAATAA
CTGCTTTATGAACTCTTCTAGCTAACCCAAAAAAGTTTATTTAAACTGTCATAAATAAAA
TTCAGATGTTCTAAGAAGAAATTTAAAGTATAAATTTCACAGTGTTATTATGAAAGGTTA
AATTGATAAATTGAGTGAATACCACTAAATAAATATGCTTTTTTCAAACTGTTGTTTCAG
TAGTTACAAGTAAATTTAAATTTTGTTAACAATTAAATAAATTAGATTTAAAAAACTAGC
CAAAACTTGACTATATCTGAGAATTGCTTACCTTTGGGTTCATCTTTACTTTAGGAGTTA
TAATATATATGCAGAATTAGAGACTGTGTTGACGAAGATTTTATTTAAAAAAAAATAAAT
GCACAATTGAATAGAGTAAATAAATATTTCATAAATTTTATATCTAAAATAATTGTTAAT
TAATTTATAGAAAATATTATCAAAGAGAAAATTGAATGATTACAATTGCGACGAATATTT
TTAAGACTCTATTTCCTCTCGAATTAATCTATAAGGCGAATGCTCTTACCAAGATGATAA
TTTTTATCAAAATTACTTTGAATTTCTTAAATAAGTTCCAACTCCTTAGTAGATTTTTAC
AAAATTAGTTTTATATAATTTTAATTTAAATTATTTAAATTTAGATTTAATTAGAATTCA
TCTGAATTAGTGCGTTAAGCTTTTATAAATTTTCAGGTAGTAAACAAATTTTAGGAGAAT
CTTCACTTTTTGACATAAAATCCTAAAATTGTTCCTTTTATTATAGAATTATCTAAAGCA
AGAGCTAAAATTGATTTCTGTGAAATAGTAAAAGAAGAACATATACAAGTAAAATATTTA
TTTTAATTAATACAAAGAAAAATAAAATGGCAAAATATTTGAAAATCTTTTTACTTTACC
ATTCTTAAACATTTAAATGAAAAAGTATTTAGATAATTAATAATTATTAAATGTTTAAAA
GGATGTAATAGATTTATTAATTGAAGGATTTTAAGAAATTTCTTAAGAAGCAGAGTTAGT
GTTCTAACAAGATGATGAAGAATAGCAACTCATGCAAGAAAATAATGAAGAAGTAACAGG
TAGAAAAATTAAGAGATGTGGTAAATAAAAGCAAGTAATGATTTATTTAAATTTTTTGAA
GGAGAGAGGGAGTACCTTTAATAGAAGAGAATTAAGACAGTATTTTGAAGAGTGTGGAAT
TCAAATTACAGGTTGCTTTGATGATTTTATAGATGAATTAAACTATAATGATTACTTGAA
ATAAATTACACAAACTTAATTTTAGCTTAACTTAGATAAGCTATGA