Identifiers and Description

Gene Model Identifier

TTHERM_00703910

Standard Name

MCM9 (DNA replication licensing factor MCM9)

Aliases

PreTt20167 | 110.m00140

Description

MCM2/3/5 family protein; Component of the MCM complex involved in DNA replication

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( TIGR02880 ) CbbX protein
  • ( PF00493 ) MCM2/3/5 family
  • ( TIGR00368 ) Mg chelatase homolog
  • ( PF01078 ) Magnesium chelatase, subunit ChlI
  • ( PF08561 ) Mitochondrial ribosomal protein L37
  • ( PF08946 ) Osmosensory transporter coiled coil
  • ( PF07562 ) Nine Cysteines Domain of family
  • ( PF07726 ) ATPase family associated with various
  • ( PF07728 ) ATPase family associated with various

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00703910

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15268.19.997093137033517e-262MCM2/3/5 family protein (742 a
a)
OxytrichaContig3653.0.g1112.0000633521090825e-149MCM2/3/5 family
DictyBaseDDB_G02860351.9992138342796362e-97mcm9 on chromosome: 4 position
3976133 to 3980036
SGDYBL023C2.0001081030036656e-67MCM2 Protein involved in DNA r
eplication; component of the M
cm2-7 hexameric complex that b
inds chromatin as a part of th
e pre-replicative complex
WormBaseWBGene000031549.99860868304602e-64locus:mcm-2 status:Partially
_confirmed UniProt:Q9XXI9
protein_id:CAA19452.1
Stentor CoeruleusSteCoe_86527.47197233734299e-43

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00703910(coding)
ATGGAAATAGAGAGAGATAATCAAAGGGATGATTAGCAAATTATTGAATATTTTTTAGAG
AATTATAGAAGGGATATACGTTTACTAATGAGAAGAATAGATCCAAGCATTTATTATAAT
TTTAGTGTTAATATGATAGAATTCTTTGATAGATTTCCTGAGAGTGCAAATAAATTTTTT
TAAAAACCTTTAGAAATGAAAAGCTTATTGGAAGAAAGTATTGTTGCTTCATAAAAATAA
TATGCAATTGATTATGCAACAACGGATAAGTATGATGAAGATGATGAATTATTTGATGCA
GTTTAGGAGATATCTGATGATTTAGGATAAGAATTAAGTGTAAAAGAGTTTGTTTTTGTT
CAATTTGTAAATATTCCCTATACAAAAGATGTTTACAAAACAAATTTGACTGACATAGGC
TCAAACGATATAAATAAGCTTGTTATAGTCTCAGGAACTGTAATAAGGACAAGTACAAGA
AAGGTATTATAAAAATCAAAGCAATTTAAGTGTTCTAACTGTGAGTAGGAATATGTTTTT
AAAGCGGAACATGAAAACTATGGAGTATTTCAAACCAATTCAATAAAGTGTAATAAATTG
ATTACTGTTGAAAAGAAGAATAATCCTTTTTACAACTTAATGCTGGACATAAAGAGAAAT
ATAAATCCAAATAACAACAATAACTACAGAAACAGATAATAAAATAATTATGAAGGAGAT
GAAATTAATGAAGAAGGGAATAATAATTCTAATAGTAGAAACAATCCAGCCTAAAATAAA
ACTGAGTAGAGGAAATGTGGCTCATAAAAATTTGAAGCTGTTGATGGAACTGAAATTTGT
ATAGACTACCAAGAAATACGTATATAAGAACCTTTTAAAACTTTAAAACCAGGAAATATA
CCCAAAACAATGTGGGTAATTCTAGAATCAAATCTTGTAGATTAAATGAAAGCAGGAGAT
GATGCGATCATTACAGGAATTCTTATTAAGAGATGGAAAAAGGCAACAAAGGATTCTCGT
CCAGAAGTTAGTTTGTGCATTATAGCTAATTCAATTTAAATTAAAAACTATCAAAAAAAT
CTGAATGACAAAGATAAAAATCAACTAAAAAGCACTCTCGAAGAAGAACTTGATAATTTC
TATAAGAAGCAAAGAGACTTAACAACTGAAATAGCTGCAAGAAATTAATTAATATAGAGT
TCATGTCCTGACATCTTTGAGAAAAATGATATAAAATTAGCAGTTTTGCTATGCCTTATA
GGAGGTGTTTCAAGAATAGAGAATAATACTCGTATAAGAGGCTAATGTCATATGATGCTA
GTTGGTGAGCCTGGAACAGGAAAATCATAAATATTAAAGTATGCAACCAAACTGTCTAAT
AGATCTGTTTTTACAACAGGAATCGGATCAACATCTGCAGGTCTAACAGTGTCATTTACT
AAAGAATAAGGTGGAGAGTGGATTATGGAAGCAGGAGCATTAGTCTTGGCAGATATGGGC
GTTTGCTGCATTGATGAATTTAATCTAATTAAAAAAGGTGATCATGACTCAGTTTTAGAA
GCTATGGAATAGCAAACTATAAGTGCCTCAAAAGCAGGTATTACATCAAAATTAAATTCT
AGGACAACAATATTGGCAGCTTGCAATCCAATTTTGCCTGGATAAAGATATTAAACAAGT
GTGGATATAACTGAAAACACTGGATTACAAAGTCCGTTGTTGAGTAGATTTGATCTGATA
TTTATTGTAAAAGATATTGTTAATTATGATGCTGATTCTGAAGCTTGCGAATTTATATTA
GAGAGATTTATGAAGAAAGAAGATAGAACAATGAACTATCAAAGAAGTGAAAGTTTATGG
GAAATCGAAAAACTTAGAGAATATATTAATTTAGTATAAAATAAATTTGAGCCAACAATT
ACCTCAGATGCATCCTAATTGATTTAAAAGTATTACTAGCACCTTAGATCAATTGAACTT
CTTCACTCTAAAACCACTATTAGAGCTTTGGAATCACTAGTTAGACTTTGTTAAGCTCAT
TCAAGACTTATGTACAGAGATAAAGTAGAAGTTTTTGATGCTATTTGTGTTATTACTCTT
CAAGAATGCAGCTATTTTACAGGACTGCTTGAAAATTTAGATCCATTAGAATATATATTA
TTAGATGAAGATAAATATGAAGAAATTGAACATGTTATTAAAAATAATTTACGCTTTATC
TCTTAACCTTGA


>TTHERM_00703910(protein)
MEIERDNQRDDQQIIEYFLENYRRDIRLLMRRIDPSIYYNFSVNMIEFFDRFPESANKFF
QKPLEMKSLLEESIVASQKQYAIDYATTDKYDEDDELFDAVQEISDDLGQELSVKEFVFV
QFVNIPYTKDVYKTNLTDIGSNDINKLVIVSGTVIRTSTRKVLQKSKQFKCSNCEQEYVF
KAEHENYGVFQTNSIKCNKLITVEKKNNPFYNLMLDIKRNINPNNNNNYRNRQQNNYEGD
EINEEGNNNSNSRNNPAQNKTEQRKCGSQKFEAVDGTEICIDYQEIRIQEPFKTLKPGNI
PKTMWVILESNLVDQMKAGDDAIITGILIKRWKKATKDSRPEVSLCIIANSIQIKNYQKN
LNDKDKNQLKSTLEEELDNFYKKQRDLTTEIAARNQLIQSSCPDIFEKNDIKLAVLLCLI
GGVSRIENNTRIRGQCHMMLVGEPGTGKSQILKYATKLSNRSVFTTGIGSTSAGLTVSFT
KEQGGEWIMEAGALVLADMGVCCIDEFNLIKKGDHDSVLEAMEQQTISASKAGITSKLNS
RTTILAACNPILPGQRYQTSVDITENTGLQSPLLSRFDLIFIVKDIVNYDADSEACEFIL
ERFMKKEDRTMNYQRSESLWEIEKLREYINLVQNKFEPTITSDASQLIQKYYQHLRSIEL
LHSKTTIRALESLVRLCQAHSRLMYRDKVEVFDAICVITLQECSYFTGLLENLDPLEYIL
LDEDKYEEIEHVIKNNLRFISQP


>TTHERM_00703910(gene)
ATGGAAATAGAGAGAGATAATCAAAGGGATGATTAGCAAATTATTGAATATTTTTTAGAG
AATTATAGAAGGGATATACGTTTACTAATGAGAAGAATAGATCCAAGCATTTATTATAAT
TTTAGTGTTAAGTAATTCATTATAAATTTTATGGTATTTATGATTGTAATTTCGCTTTTT
AATAGTATGATAGAATTCTTTGATAGATTTCCTGAGAGTGCAAATAAATTTTTTTAAAAA
CCTTTAGAAATGAAAAGCTTATTGGAAGAAAGTATTGTTGCTTCATAAAAATAATATGCA
ATTGATTATGCAACAACGGATAAGTATGATGAAGATGATGAATTATTTGATGCAGTTTAG
GAGATATCTGATGATTTAGGATAAGAATTAAGTGTAAAAGAGTTTGTTTTTGTTCAATTT
GTAAATATTCCCTATACAAAAGATGTTTACAAAACAAATTTGACTGACATAGGCTCAAAC
GATATAAATAAGCTTGTTATAGTCTCAGGAACTGTAATAAGGACAAGTACAAGAAAGGTA
TTATAAAAATCAAAGCAATTTAAGTGTTCTAACTGTGAGTAGGAATATGTTTTTAAAGCG
GAACATGAAAACTATGGAGTATTTCAAACCAATTCAATAAAGTGTAATAAATTGATTACT
GTTGAAAAGAAGAATAATCCTTTTTACAACTTAATGCTGGACATAAAGAGAAATATAAAT
CCAAATAACAACAATAACTACAGAAACAGATAATAAAATAATTATGAAGGAGATGAAATT
AATGAAGAAGGGAATAATAATTCTAATAGTAGAAACAATCCAGCCTAAAATAAAACTGAG
TAGAGGAAATGTGGCTCATAAAAATTTGAAGCTGTTGATGGAACTGAAATTTGTATAGAC
TACCAAGAAATACGTATATAAGAACCTTTTAAAACTTTAAAACCAGGAAATATACCCAAA
ACAATGTGGGTAATTCTAGAAGTAAAAATTATTTTTTCTTTAATTTCCATTTCATCAATA
AGCAAAAAATTAGTAGTTAAAGAATATTTTCTCTTAAACCCAATAAATAACATCTAATGA
ATAAACAATTTTAAACAAAAAGTCAAATCTTGTAGATTAAATGAAAGCAGGAGATGATGC
GATCATTACAGGAATTCTTATTAAGAGATGGAAAAAGGCAACAAAGGATTCTCGTCCAGA
AGTTAGTTTGTGCATTATAGCTAATTCAATTTAAATTAAAAACTATCAAAAAAGTATTTT
AAAAAATTGAAAAATTGAAAAATAATAAATAAAAAATAAATTTTTATTAGATCTGAATGA
CAAAGATAAAAATCAACTAAAAAGCACTCTCGAAGAAGAACTTGATAATTTCTATAAGAA
GCAAAGGTTTATAATTAATTGAGAGAATAGATAAATTTTAATAAATAAATTTTTAATGAT
TAGAGACTTAACAACTGAAATAGCTGCAAGAAATTAATTAATATAGAGTTCATGTCCTGA
CATCTTTGAGAAAAATGATATAAAATTAGCAGTTTTGCTATGCCTTATAGGAGGTGTTTC
AAGAATAGAGAATAATACTCGTATAAGAGGCTAATGTCATATGATGCTAGTTGGTGAGCC
TGGAACAGGAAAATCATAAATATTAAAGTATGCAACCAAACTGTCTAATAGATCTGTTTT
TACAACAGGAATCGGATCAACATCTGCAGGTCTAACAGTGTCATTTACTAAAGAATAAGG
TGGAGAGTGGATTATGGAAGCAGGAGCATTAGTCTTGGCAGATATGGGCGTTTGCTGCAT
TGATGAATTTAATCTAATTAAAAAAGTAATAAAATTAATTCAAAAAAAAAGAAAAATATA
TTTATTTCAAACATTTTATTAAGGGTGATCATGACTCAGTTTTAGAAGCTATGGAATAGC
AAACTATAAGTGCCTCAAAAGCAGGTATTACATCAAAATTAAATTCTAGGACAACAATAT
TGGCAGCTTGCAATCCAATTTTGCCTGGATAAAGATATTAAACAAGTGTGGATATAACTG
AAAACACTGGATTACAAAGTCCGTTGTTGAGTAGATTTGATCTGATATTTATTGTAAAAG
ATATTGTTAATTATGATGCTGATTCTGAAGCTTGCGAATTTATATTAGAGAGATTTATGA
AGAAAGAAGATAGAACAATGAACTATCAAAGAAGTGAAAGTTTATGGGAAATCGAAAAAC
TTAGAGAATATATTAATTTAGTATAAAATAAATTTGAGCCAACAATTACCTCAGATGCAT
CCTAATTGATTTAAAAGTATTACTAGCACCTTAGATCAATTGAACTTCTTCACTCTAAAA
CCACTATTAGAGCTTTGGAATCACTAGTTAGACTTTGTTAAGCTCATTCAAGACTTATGT
ACAGAGATAAAGTAGAAGTTTTTGATGCTATTTGTGTTATTACTCTTCAAGAATGCAGCT
ATTTTACAGGACTGCTTGAAAATTTAGATCCATTAGAATATATATTATTAGATGAAGATA
AATATGAAGAAATTGAACATGTTATTAAAAATAATTTACGCTTTATCTCTTAACCTTGA