Identifiers and Description

Gene Model Identifier

TTHERM_01031060

Standard Name

MCM8 (DNA replication licensing factor MCM8)

Aliases

PreTt22652 | 205.m00041

Description

MCM2/3/5 family protein; Component of the MCM complex involved in DNA replication

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00493 ) MCM2/3/5 family
  • ( PF00004 ) ATPase, AAA family
  • ( PF00451 ) Scorpion short toxin
  • ( PF01078 ) Magnesium chelatase, subunit ChlI
  • ( TIGR00129 ) formate dehydrogenase family accessory protein
  • ( PF07726 ) ATPase family associated with various
  • ( PF07728 ) ATPase family associated with various

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01031060

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20039.19.997093137033517e-262MCM2/3/5 family protein (817 a
a)
OxytrichaContig19212.0.g99.997093137033517e-262MCM2/3/5 family
DictyBaseDDB_G02830097.002029054921595e-161mcm8 on chromosome: 4 position
149067 to 151575
WormBaseWBGene000031563.000361869300436e-85locus:mcm-4 status:Confirmed
UniProt:Q95XQ8 protein_id
:CCD69913.1
SGDYGL201C1.0001478224244938e-84MCM6 Protein involved in DNA r
eplication; component of the M
cm2-7 hexameric complex that b
inds chromatin as a part of th
e pre-replicative complex; for
ms a subcomplex with Mcm4p and
Mcm7p
Stentor CoeruleusSteCoe_149962.3455513385429143e-59

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01031060(coding)
ATGTCTAGTTTTAAAAGAGAATCAGATTTTTATTATAAAAGTCCAGGGAGATTAACTCAT
CCAAAAAAGAATAACGAGTCTTCGCTTAGCATAATTTAGCCTGAAATGAATAATAACAGT
AACTTTGATCATACATTACTACTCGAAAAGTGGAAGGACTACTTTTAAGATGACTGCAAA
ACATTTTATGATAACGATCCAAGACATGTGATGTTGCTTTCATTTTTTGAATGTTATAGA
TTGTATTAATAATTTAAAGATATTATAGAATGGACTAACTTAAAAAGAAATGATTTATCA
GAAGCCTATGTTGATTTTATAAAACTAAAGAATTTCGATGATGAAACTTGTAAGGAAGCT
GAATTATTTAAATAAGAAATAGAAAAGGATGTTAATGATACTATAAATTCTCTTAGCTTG
GCTTTGGATTGCGTAAGAGTTCATCTGTTAGGCTAAAAAAGAAAGAAAGTGATAGTTCGC
TTATACAATTATGATTAATCAGTTTAGCTGAGAGATATTAAAGCTAATATAATTAATAAA
TATCTTTAAGTAAAGGGTGTTGTTTTGAAGACTTCTCCTGTTTAAGTTATGATTAACGAA
ATGACTTTTTAGTGTCTTGATTGCAAATAAAACTAAGTCATTAAATTTCTTTATGGCATT
TATTCCTAACCTACAAAATGCCTGAATACAAAATGCAAGGGAACTAAATTTAATCCAGAT
AAAACTAGAGCAAAAGCCAGCTTGTATCAAAGAATCAAGCTTTAAGAAATAGAAGAAGAT
GACAAAGGAAGTGGAAGAGTTCCTCGTACTTTAGAATGTGAACTAAGAGATAATCTTGTT
AATACTACAATTAATGGAGATATTGTTACTGTTTCTGGATTATTAAGAACTGAAGCTGCA
GATTTAAGCTAATAAGGCAAAAAAACAATTGGTCTGCAATCTAATGTTATGGATGTAAAC
TGTTTGACTAATTCTAAAAATGAAAATAAACTTTTAAACGAAGATGAAGAAGAATTCTCT
GAAGAAGATATAATTATGGCTTAGACTTTGAGTGATGATCCACGTGTATTCCCAAGACTT
GTTAAATCTGTTTGTCCTACAATCTTTGGGCATGAGCTAGTAAAGGCAGGACTTTTGCTT
TCTATTCTAGGTGGAGCTCCAGTTAATGAGCTTTAAGGTATTTCTAATCCATTTGCTGAT
GACAATAAAATTTCATTTAGAAGCGACTGTCATGTTCTTTTAATTGGTGATCCTGGTTTA
GGTAAATCTTAGTTATTGAAATTTTTAGCCAATATCACTACTAGATCAATATATACATGT
GGAAGCAGCTCTTCTAACGCTGGTTTGACTGTTACAGTTACAAAAGATCCAGTTACTGGT
GAAAGTACGCTCGAAGCTGGTGCTCTTATTTTGAGTGATTAAGGTGTTTGTTGTATTGAT
GAATTTGATAAAATGTCTGCTGATCATTATGTCTTGTTAGAAGCTATGGAACAATAAACA
GTTTCTCTAGCTAAAAGTGGTGTCCTTTGCTCACTTTAATCAAGAGCAACTATTATAGCT
TCAGCTAATCCAAAAGAAGGACATTATAATAAATCAAAATAAATCAAGGATAATATTAAA
ATTAATAACGCAATTCTATCTAGATTTGATTTAATTTTCCTTCTATTAGATACTCCTGAT
CCAATGAGAGATTAAAAATTATCAGAACATATTATGAAACTGCATTCAAGAAAAAGAAAG
AAAGATGAAATGGGATAGTTTGTTTAGAAATAGCCTTAATACATGCAAGATACTGAATAC
AGTTCTTTGACAGAAAAATTATAAGCTGAGTGTGCAGAAGTTACTGAAAATCTAATTCTC
TCTCCTGCTATAATGAGAAAATATATTTAGTATGTGAAGAAATTTGTTCAGCCAGTACTT
AGTAGAGAAGCTGCTGAAATTATAAAGGAATTTTATTTAACTTTGAGAGAATCACATTTT
AATACTTCATCTATTCCAATTACAAACAGACAACTTGAGTCTCTAGTAAGACTTTCATAA
GCCCGTGCAAAAATAGAATGCAGAGATATAGTGACGAAAAAGGATGCTCTTGAAGTTGTT
GAGCTGATGTAAGAAAGTTTATTTGATTCTCTTGAAGATCTAAACTACGCTCGTGGAGCA
GGTGGCACTTCTTTATAAGTTAATAAGGGTTTGAAAAATATAAACCCAAACAATATAGGA
AGTCTTAGTGTGATGAAATAAACAAAGGTCTTCTTAGAAAGATTATAATAAGAAGCATCA
ATTAAAGGTTCATATTAATTCTCCTATAACGATTTAACAACTATAGCAAAGAGCATTAAC
ATGAATGTTGGAGATTTCAGTGAGTTTATTTCAAAGCTTAATCATTAATCTATGCTTATT
TTTAGAGGTAACAAAAACTATGAATTGGCAGCAAAAAGAAATTACTGA


>TTHERM_01031060(protein)
MSSFKRESDFYYKSPGRLTHPKKNNESSLSIIQPEMNNNSNFDHTLLLEKWKDYFQDDCK
TFYDNDPRHVMLLSFFECYRLYQQFKDIIEWTNLKRNDLSEAYVDFIKLKNFDDETCKEA
ELFKQEIEKDVNDTINSLSLALDCVRVHLLGQKRKKVIVRLYNYDQSVQLRDIKANIINK
YLQVKGVVLKTSPVQVMINEMTFQCLDCKQNQVIKFLYGIYSQPTKCLNTKCKGTKFNPD
KTRAKASLYQRIKLQEIEEDDKGSGRVPRTLECELRDNLVNTTINGDIVTVSGLLRTEAA
DLSQQGKKTIGLQSNVMDVNCLTNSKNENKLLNEDEEEFSEEDIIMAQTLSDDPRVFPRL
VKSVCPTIFGHELVKAGLLLSILGGAPVNELQGISNPFADDNKISFRSDCHVLLIGDPGL
GKSQLLKFLANITTRSIYTCGSSSSNAGLTVTVTKDPVTGESTLEAGALILSDQGVCCID
EFDKMSADHYVLLEAMEQQTVSLAKSGVLCSLQSRATIIASANPKEGHYNKSKQIKDNIK
INNAILSRFDLIFLLLDTPDPMRDQKLSEHIMKLHSRKRKKDEMGQFVQKQPQYMQDTEY
SSLTEKLQAECAEVTENLILSPAIMRKYIQYVKKFVQPVLSREAAEIIKEFYLTLRESHF
NTSSIPITNRQLESLVRLSQARAKIECRDIVTKKDALEVVELMQESLFDSLEDLNYARGA
GGTSLQVNKGLKNINPNNIGSLSVMKQTKVFLERLQQEASIKGSYQFSYNDLTTIAKSIN
MNVGDFSEFISKLNHQSMLIFRGNKNYELAAKRNY


>TTHERM_01031060(gene)
ATGTCTAGTTTTAAAAGAGAATCAGATTTTTATTATAAAAGTCCAGGGAGATTAACTCAT
CCAAAAAAGAATAACGAGTCTTCGCTTAGCATAATTTAGCCTGAAATGAATAATAACAGT
AACTTTGATCATACATTACTACTCGAAAAGTGGAAGGACTACTTTTAAGATGACTGCAAA
ACATTTTATGTAAAAAAAAAATAATAATTTTTAAAGAATTAAATGTAAAAGGATTTGGTC
ATATTTAATTTATTCGAAAGAAGACATATTTTTTAAGTGAATTATCAAAATAATTTATGA
TATAAAATTGATTAAATTTTTAAGATAGATATTTTTTAAATGAAAAAAAGGATAACGATC
CAAGACATGTGATGTTGCTTTCATTTTTTGAATGTTATAGATTGTATTAATAATTTAAAG
ATATTATAGAATGGACTAACTTAAAAAGAAATGATTTATCAGAAGCCTATGTTGATTTTA
TAAAACTAAAGAATTTCGATGATGAAACTTGTAAGGAAGCTGAATTATTTAAATAAGAAA
TAGAAAAGGATGTTAATGATACTATAAATTCTCTTAGCTTGGCTTTGGATTGCGTAAGAG
TTCATCTGTTAGGCTAAAAAAGAAAGAAAGTGATAGTTCGCTTATACAATTATGATTAAT
CAGTTTAGCTGAGAGATATTAAAGCTAATATAATTAATAAATATCTTTAAGTAAAGGGTG
TTGTTTTGAAGACTTCTCCTGTTTAAGTTATGATTAACGAAATGACTTTTTAGTGTCTTG
ATTGCAAATAAAACTAAGTCATTAAATTTCTTTATGGCATTTATTCCTAACCTACAAAAT
GCCTGAATACAAAATGCAAGGGAACTAAATTTAATCCAGATAAAACTAGAGCAAAAGCCA
GCTTGTATCAAAGAATCAAGCTTTAAGAAATAGAAGAAGATGACAAAGGAAGTGGAAGAG
TTCCTCGTACTTTAGAATGTGAACTAAGAGATAATCTTGTTAATACTACAATTAATGGAG
ATATTGTTACTGTTTCTGGATTATTAAGAACTGAAGCTGCAGATTTAAGCTGTATTTAAC
ATTTTTAAAATGAACTACAATAAAATTAATTATTGCTTAAAATAAACTTAAATTTAATAC
ATTTTATTTTTGACTTTCTTTTAATTCATATTTTAAAATTTAAAAGAATAAGGCAAAAAA
ACAATTGGTCTGCAATCTAATGTTATGGATGTAAACTGTTTGACTAATTCTAAAAATGAA
AATAAACTTTTAAACGAAGATGAAGAAGAATTCTCTGAAGAAGATATAATTATGGCTTAG
ACTTTGAGTGATGATCCACGTGTATTCCCAAGACTTGTTAAATCTGTTTGTCCTACAATC
TTTGGGCATGAGCTAGTAAAGGCAGGACTTTTGCTTTCTATTCTAGGTGGAGCTCCAGTT
AATGAGCTTTAAGGTATTTCTAATCCATTTGCTGATGACAATAAAATTTCGTAATTTACT
TAGATACATTCAAGTTTCTTATTTGAAATTTTAAACTATTTATTTATTTTAGATTTAGAA
GCGACTGTCATGTTCTTTTAATTGGTGATCCTGGTTTAGGTGTGACTTACTTTTTATAAT
TCTATCATTTTTAATAAACTAATTAATTATTGTTTTTACTCAAAAAGGTAAATCTTAGTT
ATTGAAATTTTTAGCCAATATCACTACTAGATCAATATATACATGTGGAAGCAGCTCTTC
TAACGCTGGTTTGACTGTTACAGTTACAAAAGATCCAGTTACTGGTGAAAGTACGCTCGA
AGCTGGTGCTCTTATTTTGAGTGATTAAGGTGTTTGTTGTATTGATGAATTTGATAAAAT
GTCTGCTGATCATTATGTCTTGTTAGAAGCTATGGAACAATAAACAGTTTCTCTAGCTAA
AAGTGGTGTCCTTTGCTCACTTTAATCAAGAGCAACTATTATAGCTTCAGCTAATCCAAA
AGAAGGACATTATAAGTAATTTAATGTTTTTTATCAATAAAAAATAACACATTATTTAAA
ATAAAAAGTAAATCAAAATAAATCAAGGATAATATTAAAATTAATAACGCAATTCTATCT
AGATTTGATTTAATTTTCCTTCTATTAGATACTCCTGATCCAATGAGAGATTAAAAATTA
TCAGAACATATTATGAAAGTAATTTTTAAAAAATTAATTTTTATTTTATTAAATTAAATT
AAAAATATTTTTGTTAAAGGGTTTTTTTTTAATTTTAAAATTATTTAATTCAATTCTTTA
CAATTTTTTAAAGATTATATTCTTTATTTTGAATAATGAATAAATTAATCAACAGCTGCA
TTCAAGAAAAAGAAAGAAAGATGAAATGGGATAGTTTGTTTAGAAATAGCCTTAATACAT
GCAAGATACTGAATACAGTTCTTTGACAGAAAAATTATAAGCTGAGTGTGCAGAAGTTAC
TGAAAATCTAATTCTCTCTCCTGCTATAATGAGAAAATATATTTAGTATGTGAAGAAATT
TGTTCAGCCAGTGTAAATAATTTATTTAGTTTTGATATTTAAATAAATCCTTTAAAATAA
TAAATAAATATTTAGACTTAGTAGAGAAGCTGCTGAAATTATAAAGGAATTTTATTTAAC
TTTGAGAGAATCACATTTTAATACTTCATCTATTCCAATTACAAACAGACAACTTGAGTC
TCTAGTAAGACTTTCATAAGCCCGTGCAAAAATAGAATGCAGAGATATAGTGACGAAAAA
GGATGCTCTTGTATTTTGATTTTCGAATAATTTAGACCAAATAAATTTATTGACATCAAA
TTTATTTAAAAATTAGGAAGTTGTTGAGCTGATGTAAGAAAGTTTATTTGATTCTCTTGA
AGATCTAAACTACGCTCGTGGAGCAGGTGGCACTTCTTTATAAGTTAATAAGGGTTTGAA
AAATATAAACCCAAACAATATAGGAAGTCTTAGTGTGATGAAATAAACAAAGGTCTTCTT
AGAAAGATTATAATAAGAAGCATCAATTAAAGGTTCATATTAATTCTCCTATAACGATTT
AACAACTATAGCAAAGAGCATTAACATGAATGTTGGAGATTTCAGTGAGTTTATTTCAAA
GCTTAATCATTAATCTATGCTTATTTTTAGAGGTAACAAAAACTATGAATTGGCAGCAAA
AAGAAATTACTGA