Identifiers and Description

Gene Model Identifier

TTHERM_00011740

Standard Name

MCM7 (DNA replication licensing factor MCM7)

Aliases

PreTt11780 | 1.m00828

Description

MCM7 MCM2/3/5 family protein; Component of the Mcm2-7 complex involved in DNA replication

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( TIGR02880 ) CbbX protein
  • ( PF00493 ) MCM2/3/5 family
  • ( TIGR00166 ) ribosomal protein S6
  • ( TIGR00368 ) Mg chelatase homolog
  • ( PF08573 ) DNA repair protein SAE2
  • ( PF01078 ) Magnesium chelatase, subunit ChlI
  • ( PF03413 ) Peptidase propeptide and YPEB domain
  • ( PF05316 ) Mitochondrial ribosomal protein (VAR1)
  • ( PF07726 ) ATPase family associated with various
  • ( PF07728 ) ATPase family associated with various

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00011740

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02773.19.997093137033517e-262MCM2/3/5 family protein (1371
aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00011740(coding)
ATGATTAATAAAAGGACAAGCTTCACCTCTAAGATGTTAAGCGGGAGGAAAAATTCTTGT
TAATCAACAACTTCTTCAGCAGAATCTCACAACTTTAGGAGCACAAATGATATAGATCAT
AAAGTGCATCTGATAGAAAAATCACCCAATAAATACAAGTTGATAACTGAAAACAAACAA
ACACAAAATAAGAGTCAGCTAAGAAGACTGAACAACTTGAAGCTACTAGGATTTATAAAG
GTTAAGGAATGCGGAGGTGCAGATCTTAAAAATGAATAAGAATAATAGCTACAATTTAAA
AAAACATTCAAAGTGAATTAAAAAGGATTAATTTTTGATAATCATTAATACTTTCTTAAC
CTTAATGCGGTGATAAGCAACAATCACTTGATAAGATAATCTAGTCCAGTAGAAAGGTTA
AAGGCTAATCTTTACGATGAAGAGAGAGTTCCTTAAATTAGCTAATATATTAAGACTAAT
AGTACCAATTTTTAAGATACTCCTCTGAGTTAAACTAATTAATATAATCTTATTTCCTGC
TCAAATGGTAGTAACAATAACAAAAAGAAAGCAGCTTTTCGTCGTCGTAGCTGCTATTGC
AACTAAACTGGTAAGTAAAGCCAAAAAGCTTAAAAAATAGACTTCTAATTGCCTACAACC
TTCATTAAAAATAGAATTTACTAGCGTATGAAAAGAAAGTAGGAAATGAAAATGAATTTG
AATGAAAAAGATTTGATTATTTAGAATTTAAATCGTACATTCGACATTCAAGAAAAGAAT
TCTGCTCGCGGAAGTCTGCTAAATAGTCCTAATATCATGAATATGCAGCAAACATTTAAC
TTTTTAGACACTCCTATGTCAGGAAGAGTTATGAATACACCTAGCGCAAGCAATAGGTAT
AACAATTAACACCACGTCCATTCAAGCTAAGCTTAAAGAAGCTAATTTTCTTACATGACA
TCACCAAAGAATGGCTAACAACATTCTAATTAAGGAACTGCCACTCATAGTAAGAAAGAT
GATAACACATTAAAAAATGCTCAAAGTCCTGTAAATCGTAATCCTAACAGCAAGCCTACA
TTCGCAGAAACTATTGAATATATCAAAGAAGAACAGAGTCAACAGTAAAATGTTACTCCT
TAATCTAAATAAGAAAAAAAATCACCTCAAAAAACAAACTCATAAATCTCTAGCAAAGAG
TTGGAGTTATCTTTAAATAAAGTAGTTCATCGTAAAAATATTTCTAGCAATAAAAATTCC
CCTAAAAATAATCATGTTTCTGCTTCTCCTAATCGCTAAACTCCTGTAAGCAGCAGCAAG
AAGAGTAGCATGTTCAACTACTTTGGCGTAGGAGGAAAAACCTTAAAGGACGACTCACAC
TAAAAATAATAATATGAAAGCATTTATCCAGAACAAGTGGAGAAAAGAAAAAAATGGATC
ACAAAGCTTCGTATTGCTACCAAATTAGTTGGTTTTTAAGAAAAACAAAGAAAAAAATCT
ATGTTGTACTAGTAAGATTATTACAAGGCACTTGAAGAAGTTGCAAATAACGAGGTTGAG
CTTGAAAATTTAGAATAAAATGATGAATTTAATCACAATAATTAGGAGAAAAAAAACATT
TTAATTAGAAAAGTCAAATAAAGCAATATCAATAAAAATAATTTTATGCTAAATTAAATA
GTAAAGCAACACAACTTAAAATTCAATTCCACAATAGGCTCTTTTCTTGATATGCGCACT
AAAAGTCAAAATTGTCTTCTTCCTTCAACGAATTCTTCCATCTTTGCCTTCCCTTAGAAA
TTGAGTAGAAGACATTTAGTAAGCCCATTCAATTACGACAGCAAATCGGAATATATTATC
CATAAAAAGGATAGTAAAATAGGTGCTTATCTGTAGCCCTTCCCAGTAATTCTTTCGCCA
TCTCCAAGCAAATAAGATCATAGTAAAAAATCTCAGAGCAAAACAAACTAGCTTTTCTAA
TCATCTTTTGTTACAAATACTGATAAAAAAAATAAAAAATCGAATGAGATAATCAATAGA
AGTAGTTCTCATAAAAAAATTAACTCATCAACAATGACAGAACTTGGTAAAGGAAATTAA
AATAAAAATCATTTTAGTAAGAATTATTTGCTCATGCCAAAAAGTGCGAAATCTGGTTAA
ATTTAATTAAGTAATTCATCAAATAGCATAGAAGAATTGAATGCTACTGAAAATAATCTC
TAGAATGAAGCAAGTAAATCTAGTCTAGGATTAAAATCTAATAACGATAAAGACAGCCAC
TAAAATAGCCAGCAAAATATAGTAAGTCTTGAATAGCTCGGAAGATATGAAACATATTTT
GCAAAAAAGCCAGATTAAAAAAATTAAAAAGTTAACAATTAATCAAAAACTTAGCAAAAA
TTCTAGCTGCTCATAAACAATTAGTCGATACAAAACTCTTATTTAATAAAAAGCAATTTA
AAAAATTCAAATTCTATAAATCACTTAAGTAAAACCATAAATTTTGGTTAAATTAATCAA
AAAACAGCTTCATAGCCTGATTTACTTCAAAGTACTTTCAAGCACGACACATCAAATGTA
TCATCTAACAATTTGACCATAAAAAGTCCAAATATTTAAAACAGAAGACCCAGCTATCTT
TAGCAAAAATTTGAAAGTAAGACCCATCGTAAATCAATCCTACAGAGCTATTTGGTTTGA


>TTHERM_00011740(protein)
MINKRTSFTSKMLSGRKNSCQSTTSSAESHNFRSTNDIDHKVHLIEKSPNKYKLITENKQ
TQNKSQLRRLNNLKLLGFIKVKECGGADLKNEQEQQLQFKKTFKVNQKGLIFDNHQYFLN
LNAVISNNHLIRQSSPVERLKANLYDEERVPQISQYIKTNSTNFQDTPLSQTNQYNLISC
SNGSNNNKKKAAFRRRSCYCNQTGKQSQKAQKIDFQLPTTFIKNRIYQRMKRKQEMKMNL
NEKDLIIQNLNRTFDIQEKNSARGSLLNSPNIMNMQQTFNFLDTPMSGRVMNTPSASNRY
NNQHHVHSSQAQRSQFSYMTSPKNGQQHSNQGTATHSKKDDNTLKNAQSPVNRNPNSKPT
FAETIEYIKEEQSQQQNVTPQSKQEKKSPQKTNSQISSKELELSLNKVVHRKNISSNKNS
PKNNHVSASPNRQTPVSSSKKSSMFNYFGVGGKTLKDDSHQKQQYESIYPEQVEKRKKWI
TKLRIATKLVGFQEKQRKKSMLYQQDYYKALEEVANNEVELENLEQNDEFNHNNQEKKNI
LIRKVKQSNINKNNFMLNQIVKQHNLKFNSTIGSFLDMRTKSQNCLLPSTNSSIFAFPQK
LSRRHLVSPFNYDSKSEYIIHKKDSKIGAYLQPFPVILSPSPSKQDHSKKSQSKTNQLFQ
SSFVTNTDKKNKKSNEIINRSSSHKKINSSTMTELGKGNQNKNHFSKNYLLMPKSAKSGQ
IQLSNSSNSIEELNATENNLQNEASKSSLGLKSNNDKDSHQNSQQNIVSLEQLGRYETYF
AKKPDQKNQKVNNQSKTQQKFQLLINNQSIQNSYLIKSNLKNSNSINHLSKTINFGQINQ
KTASQPDLLQSTFKHDTSNVSSNNLTIKSPNIQNRRPSYLQQKFESKTHRKSILQSYLV


>TTHERM_00011740(gene)
ATGATTAATAAAAGGACAAGCTTCACCTCTAAGATGTTAAGCGGGAGGAAAAATTCTTGT
TAATCAACAACTTCTTCAGCAGAATCTCACAACTTTAGGAGCACAAATGATGTAATAAAT
ACATTATTAATTAATAAATATAGTTTGATATTGTAAATATGATGGTAAAGCAACCTTTTT
ATAAAAAAACTAGATAGATCATAAAGTGCATCTGATAGAAAAATCACCCAATAAATACAA
GTTGATAACTGAAAGTAAAATTGAAATAGTATTTTAAAAAAACACTCAATAAAAATAATT
AATAAAAGACAAACAAACACAAAATAAGAGTCAGCTAAGAAGACTGAACAACTTGAAGCT
ACTAGGATTTATAAAGGTTAAGGAATGCGGAGGTGCAGATCTTAAAAATGAATAAGAATA
ATAGCTACAATTTAAAAAAACATTCAAAGTGAATTAAAAAGGATTAATTTTTGATAATCA
TTAATACTTTCTTAACCTTAATGCGGTGATAAGCAACAATCACTTGATAAGTAATTATTC
TATTTATTCATTTTATTAAATATTTTTCACTCAATAGGAATAATAATTAAGCATGATTTA
TTCTTAGTATGCAAATTAAATAAAAAAATATTTAATTTCTTTTAAATTAGTTAGAAACTA
CCTTATTTTTTTAATTTATCAATCAATCAATCACTCATTTATCTATTCACTATTCACACT
ATTTACTGATTCAGTCATTAAAAAAATATTTGATTTTCATATATAAATATCTATTTACAG
CCTTTACTCTTTTTAATTTATTGTAATCAATCAATTTGACTGACTGAATGAGTCATCAAA
ATAAATTCATTAATATTTTGCTAGTTTAGCATATTTCTTTTTAATCGTCAATATAAACTG
GATCAAGCTTTACTTCTGAATCGACATATTAAGCAAATCTTAATAACTAAAATAATTTTT
CCATATCAAATAATGAGAGGTCCGAAAAAATTATGAAGATATTTCAATTTTTATTATGAG
CAAATATCATTTCGGGATTGGATTAATAAATATTTTTTAATATTCTTAAGAAGTTACAAC
GCAGAAGCAGCTCTAATTAATTCACATATTTTATTTATTCTTTTCAGTTAATACGTTGCT
AATTTCAGTAGTTGAAATAATGATATAATAATGATATAGATTTACAAACGGAAGTATATA
TTTATTTATTTTATATTTCAACTAAGTCATTTGCGATTATTTTGTTGAAAAAAGAACTTT
TCTAAATAAAGATTGAATTTATTTTGTATTTAGTTAAGCAAAGATAAAATCAATATGAAT
TTTCCTCTGCAATTAAATATACAAAGAGAATATTATTATTAAATAGAAATTTGAATGAGT
GGTTGATTGATTGAATGTAAATAAAATGAGGATTTGCAAAAGAAAAGATTGCATTAATAG
ATTAATTTTTAATATGATTAGAGAATAAAATTGAATTATTTTTATAAATTTAAATTATAC
ATTTATAATTTTAATTTTATTCAATTTTAGGATAATCTAGTCCAGTAGAAAGGTTAAAGG
CTAATCTTTACGATGAAGAGAGAGTTCCTTAAATTAGCTAATATATTAAGACTAATAGTA
CCAATTTTTAAGATACTCCTCTGAGTTAAACTAATTAATATAATCTTATTTCCTGCTCAA
ATGGTAGTAACAATAACAAAAAGAAAGCAGCTTTTCGTCGTCGTAGCTGCTATTGCAACT
AAACTGGTAAGTAAAGCCAAAAAGCTTAAAAAATAGACTTCTAATTGCCTACAACCTTCA
TTAAAAATAGAATTTACTAGCGTATGAAAAGAAAGTAGGAAATGAAAATGAATTTGAATG
AAAAAGATTTGATTATTTAGAATTTAAATCGTACATTCGACATTCAAGAAAAGAATTCTG
CTCGCGGAAGTCTGCTAAATAGTCCTAATATCATGAATATGCAGCAAACATTTAACTTTT
TAGACACTCCTATGTCAGGAAGAGTTATGAATACACCTAGCGCAAGCAATAGGTATAACA
ATTAACACCACGTCCATTCAAGCTAAGCTTAAAGAAGCTAATTTTCTTACATGACATCAC
CAAAGAATGGCTAACAACATTCTAATTAAGGAACTGCCACTCATAGTAAGAAAGATGATA
ACACATTAAAAAATGCTCAAAGTCCTGTAAATCGTAATCCTAACAGCAAGCCTACATTCG
CAGAAACTATTGAATATATCAAAGAAGAACAGAGTCAACAGTAAAATGTTACTCCTTAAT
CTAAATAAGAAAAAAAATCACCTCAAAAAACAAACTCATAAATCTCTAGCAAAGAGTTGG
AGTTATCTTTAAATAAAGTAGTTCATCGTAAAAATATTTCTAGCAATAAAAATTCCCCTA
AAAATAATCATGTTTCTGCTTCTCCTAATCGCTAAACTCCTGTAAGCAGCAGCAAGAAGA
GTAGCATGTTCAACTACTTTGGCGTAGGAGGAAAAACCTTAAAGGACGACTCACACTAAA
AATAATAATATGAAAGCATTTATCCAGAACAAGTGGAGAAAAGAAAAAAATGGATCACAA
AGCTTCGTATTGCTACCAAATTAGTTGGTTTTTAAGAAAAACAAAGAAAAAAATCTATGT
TGTACTAGTAAGATTATTACAAGGCACTTGAAGAAGTTGCAAATAACGAGGTTGAGCTTG
AAAATTTAGAATAAAATGATGAATTTAATCACAATAATTAGGAGAAAAAAAACATTTTAA
TTAGAAAAGTCAAATAAAGCAATATCAATAAAAATAATTTTATGCTAAATTAAATAGTAA
AGCAACACAACTTAAAATTCAATTCCACAATAGGCTCTTTTCTTGATATGCGCACTAAAA
GTCAAAATTGTCTTCTTCCTTCAACGAATTCTTCCATCTTTGCCTTCCCTTAGAAATTGA
GTAGAAGACATTTAGTAAGCCCATTCAATTACGACAGCAAATCGGAATATATTATCCATA
AAAAGGATAGTAAAATAGGTGCTTATCTGTAGCCCTTCCCAGTAATTCTTTCGCCATCTC
CAAGCAAATAAGATCATAGTAAAAAATCTCAGAGCAAAACAAACTAGCTTTTCTAATCAT
CTTTTGTTACAAATACTGATAAAAAAAATAAAAAATCGAATGAGATAATCAATAGAAGTA
GTTCTCATAAAAAAATTAACTCATCAACAATGACAGAACTTGGTAAAGGAAATTAAAATA
AAAATCATTTTAGTAAGAATTATTTGCTCATGCCAAAAAGTGCGAAATCTGGTTAAATTT
AATTAAGTAATTCATCAAATAGCATAGAAGAATTGAATGCTACTGAAAATAATCTCTAGA
ATGAAGCAAGTAAATCTAGTCTAGGATTAAAATCTAATAACGATAAAGACAGCCACTAAA
ATAGCCAGCAAAATATAGTAAGTCTTGAATAGCTCGGAAGATATGAAACATATTTTGCAA
AAAAGCCAGATTAAAAAAATTAAAAAGTTAACAATTAATCAAAAACTTAGCAAAAATTCT
AGCTGCTCATAAACAATTAGTCGATACAAAACTCTTATTTAATAAAAAGCAATTTAAAAA
ATTCAAATTCTATAAATCACTTAAGTAAAACCATAAATTTTGGTTAAATTAATCAAAAAA
CAGCTTCATAGCCTGATTTACTTCAAAGTACTTTCAAGCACGACACATCAAATGTATCAT
CTAACAATTTGACCATAAAAAGTCCAAATATTTAAAACAGAAGACCCAGCTATCTTTAGC
AAAAATTTGAAAGTAAGACCCATCGTAAATCAATCCTACAGAGCTATTTGGTTTGA