Identifiers and Description

Gene Model Identifier

TTHERM_00448570

Standard Name

MCM6 (DNA replication licensing factor MCM6)

Aliases

PreTt15376 | 52.m00154 | 3811.m00917

Description

Component of the Mcm2-7 complex involved in DNA replication

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00448570

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
WormBaseWBGene000031589.997093137033517e-262locus:mcm-6 DNA replication
licensing factor mcm-6 statu
s:Confirmed UniProt:P34647
protein_id:CAA80191.1
Tetrahymena borealisEI9_14945.19.997093137033517e-262MCM2/3/5 family protein (825 a
a)
DictyBaseDDB_G02727609.997093137033517e-262mcm6 on chromosome: 2 position
2111171 to 2113956
OxytrichaContig21040.0.g239.997093137033517e-262MCM2/3/5 family
SGDYGL201C9.997093137033517e-262MCM6 Protein involved in DNA r
eplication; component of the M
cm2-7 hexameric complex that b
inds chromatin as a part of th
e pre-replicative complex; for
ms a subcomplex with Mcm4p and
Mcm7p
Stentor CoeruleusSteCoe_41885.0345753587649823e-45

General Information

Paragraph NoGene NameParagraph Text
72MCM6Gene Information: MCM6 is a gene coding for a protein product associated with replicative origins in G1 phase during pre-replicative complex assembly. ORC recruits MCM6p on non-rDNA chromosomes. Mcm6p ChIP analysis was performed with affinity-purified rabbit antibodies directed against amino acids 34–51 (GKKIKYYREKALLLKIYE) of the T. thermophila MCM6 protein (Tetrahymena Genome Database gene prediction: TTHERM-00448570, e value versus human MCM6 (NP_005906.2): 1.0e-172. Human MCM6 (NP_005906.2) versus TGD TTHERM-0048570 e value : 1.0e-178.
73MCM6Nucleic Acid Interactions: Non-rDNA and rDNA origin in cells synchronized at the G1/S border.
74MCM6Protein Interaction Partners: Not assessed
75MCM6Biochemical Activities: Predicted helicase activity for dsDNA as a component of MCM2-7 complex

Associated Literature

  1. Ref:19153611: Donti TR, Datta S, Sandoval PY, Kapler GM (2009) Differential targeting of Tetrahymena ORC to ribosomal DNA and non-rDNA replication origins. The EMBO journal 28(3):223-33

Sequences

>TTHERM_00448570(coding)
ATGAGCTAGATGAACTTTTCCTAAACAATCTAACTTAAGATTGAAACAGTAAAGACCTAA
TTCCTTAACTTCTTAAACAACTTTGAAGTAGTTGAAAATGGAAAAAAAATCAAGTATTAC
AGAGAAAAGGCACTTTTGTTGAAGATTTATGAAAAGAATACACTTTTTATTGACTTTAAT
CACTTATTAGATTTTATTGATGACAACGATATTTCAGATGTCATTTTAAACGACTACTAC
AAAATTGAACCTCACTTAAGAAAAATTGTTTCAAATTTCATCTTTAGTCTAACCAACACA
AACGATAGCCAGGAAAGTTACTACCTTAGCTTTTACAACTTACCAACTGAAAAGAAAATT
AGAGAATTGGGAACTTAAGAAATAGGTAAATTGAATAGTATTAAGGGTTTAGTTACTAGA
TCAAGTGAAGTACGTCCTGAATTACTTTATGGTACATTTATTTGCCAATTGTGTAATAGT
GAAGTGCGTGATATTGAGTAGCAATTTAAATACACTGAACCTAAAATATGTTCAAACCCT
GGCTGTAACAACCATACTAAGTGGATGTTAAAACCCTAATCATCAGTATTTTCTGATTTT
TAGAAACTTAGAGTTCAAGAAGAATCTACTGACATTCCTGCAGGAGGTATGCCTCGTTCT
ATTGATATTGTTTGTAGAGGTGAAGTTGTTGACACCGCTAAGCCTGGTGATAAATGTATT
TTCACTGGTTATTTAATTGTTGTTCCTGATATAGCAGCTCTTACTAAACCAGGTGAAAAA
ACTGAAATGGGTATTAAATCTGATGCCGTTAGAGTCAAAGGAGAAGGAAATAATGATGGT
ATTACTGGTCTCTCTCAACTAGGTCAAAGAGATTTGAACTACAGACTTGTTTTCTTAGCT
ATTAACATTGAAGCAAAAAAGAGTAGATTCAACTTATGGAATTAAGATGAAGAAGAAAAT
CAGGATTTAACTGAAGAAGAAGAAAGACAAAAAATTATGGAAAATTTCTCTGAAAGAGAA
CTTGAAGACATTTTTAAAATAAGCAGAAGTTCTAATGTTTATGAAAGATTAGCATCTAGT
TTGTGTCCTACTGTACATGGTCACTTGGAAGTTAAAAAGGGTATTTTACTCATGCTTTTT
GGTGGTGTCAACAAAAAAACAGAAGAAGGTATTAACTTGAGAGGTGATATCAACATTTGC
ATGGTAGGTGATCCATCTACTGCTAAGTCTCAATTCCTTAAATATGTTAATAAGCTTATT
CCTCGTTCAGTCTATACTTCTGGTAAAGCATCAACATCTGCTGGTTTGACTGCAAGTGTT
TCTAAAGATCCTGAAACTGGAGAAAATTGCATTGAAGCTGGTGCTTTGATGCTTTCTGAC
TAAGGTATTTGCTGTATCGATGAATTTGATAAGATGGATAAAAGAGATTAAGTCGCCATC
CACGAAGCTATGGAACAATAAACAATTTCTATTTCAAAGGCAGGTATTCAAGCTACCTTG
AATTCAAGAGCCAGTATTTTAGCTGCTGCAAACCCTGTTTTTGGTAGATACGATAAATCC
AAGGGTTTAAAATACAACTTAGATATAAGCGCTCCCATTCTTTCTCGTTTCGATTTATTC
TTTGTCATTTTGGATGAGTGCAACGAATAATCAGATAGAATGATTGCATAACATATTGTT
AATATTCATTAAAGCTGTGGAAGAAATATCAATCCTGAAATCAGTACTGAAGATTTGTCT
AAGTATATACGTTTTGCTAGAACTATAAAGCCAATTTTCACTCGTGAAGCTGCCCTCGAA
TTGCAAAAATGCTATGTAAAACTTAGATAAAATGATTCAAGCTCTTAAAATACTTCATAC
AGAATTACAGTCAGACAGCTTGAATCTCTTATTAGATTAAGTGAAGCTTTGGCTAGAGTT
CACATTCAATCAGAAGTTACTGCTGAATTTGTATAGGAAGCCGCAAGATTACTCAGCAAT
TCTATTCTTAAAATAGAAAAGGGATAATTGGACATCTAAGATGAAGAAGAGCAAAAGATA
GACCTCAACTAATAAAAAGAATAAGGCTAAAACATTATTTAAGAAGATATTGAAAAAAAA
CAACAATAATAAAGAAAGAAGGAAGGTAAAATCTCAATTACTTATGAGGAATACTTAAAC
ATGAGAAAGATAATCATTCAAACAGTCAAAGATTTAGAAATAGAAGATAGTCTTAGAGTT
TCCACAGAAGGAGAAGACGGAATGGAAGTTGAAAGACAAAATGGTTTCGAATAAAGAGTT
ATTATAGAATAAATTCTTAAGCAATTATTAGAAAATGACCTTATCCAAACAGAAGAAGAT
GCTACTAAATTAAAAAAAATATATTCTCAAATTATTAAAAAGTTAGTAGATGTAGACTAA
GTTTTAATTGTTGTCGAAGAGGCCTCAAATTTAGACGAACGTAGATTATAACTTCATGCT
AACTACTGCGAACCTAGTTGA


>TTHERM_00448570(protein)
MSQMNFSQTIQLKIETVKTQFLNFLNNFEVVENGKKIKYYREKALLLKIYEKNTLFIDFN
HLLDFIDDNDISDVILNDYYKIEPHLRKIVSNFIFSLTNTNDSQESYYLSFYNLPTEKKI
RELGTQEIGKLNSIKGLVTRSSEVRPELLYGTFICQLCNSEVRDIEQQFKYTEPKICSNP
GCNNHTKWMLKPQSSVFSDFQKLRVQEESTDIPAGGMPRSIDIVCRGEVVDTAKPGDKCI
FTGYLIVVPDIAALTKPGEKTEMGIKSDAVRVKGEGNNDGITGLSQLGQRDLNYRLVFLA
INIEAKKSRFNLWNQDEEENQDLTEEEERQKIMENFSERELEDIFKISRSSNVYERLASS
LCPTVHGHLEVKKGILLMLFGGVNKKTEEGINLRGDINICMVGDPSTAKSQFLKYVNKLI
PRSVYTSGKASTSAGLTASVSKDPETGENCIEAGALMLSDQGICCIDEFDKMDKRDQVAI
HEAMEQQTISISKAGIQATLNSRASILAAANPVFGRYDKSKGLKYNLDISAPILSRFDLF
FVILDECNEQSDRMIAQHIVNIHQSCGRNINPEISTEDLSKYIRFARTIKPIFTREAALE
LQKCYVKLRQNDSSSQNTSYRITVRQLESLIRLSEALARVHIQSEVTAEFVQEAARLLSN
SILKIEKGQLDIQDEEEQKIDLNQQKEQGQNIIQEDIEKKQQQQRKKEGKISITYEEYLN
MRKIIIQTVKDLEIEDSLRVSTEGEDGMEVERQNGFEQRVIIEQILKQLLENDLIQTEED
ATKLKKIYSQIIKKLVDVDQVLIVVEEASNLDERRLQLHANYCEPS


>TTHERM_00448570(gene)
ATGAGCTAGATGAACTTTTCCTAAACAATCTAACTTAAGATTGAAACAGTAAAGACCTAA
TTCCTTAACTTCTTAAACAAGTATATTGCAATTATTGATTAACAAATAATTTTAATAATA
ATTTATTTCTAATAGCTTTGAAGTAGTTGAAAATGGAAAAAAAATCAAGTATTACAGAGA
AAAGGCACTTTTGTTGAAGATTTATGAAAAGAATACACTTTTTATTGACTTTAATCACTT
ATTAGATTTTATTGATGACAACGATATTTCAGATGTCATTTTAAACGACTACTACAAAAT
TGAACCTCACTTAAGAAAAATTGTTTCAAATTTCATCTTTAGTCTAACCAACACAAACGA
TAGCCAGTAATAAATAAATAATTTAATATTTTTTAATGATAAATTACTTTTGTAATGATA
AATAAAGATGCATGCTCTCTCAACAATGAGCTAGTTTATGATTTAGATATTTGATAAATG
AATGAATTACTATTATGATATTTTAATCTATTTTTTTATAATCAATTAGGGAAAGTTACT
ACCTTAGCTTTTACAACTTACCAACTGAAAAGAAAATTAGAGAATTGGGAACTTAAGAAA
TAGGTAAATTGAATAGTATTAAGGGTTTAGTTACTAGATCAAGTGAAGTACGTCCTGAAT
TACTTTATGGTACATTTATTTGCCAATTGTGTAATAGTGAAGTGCGTGATATTGAGTAGC
AATTTAAATACACTGAACCTAAAATATGTTCAAACCCTGGCTGTAACAACCATACTAAGT
GGATGTTAAAACCCTAATCATCAGTATTTTCTGATTTTTAGAAACTTAGAGTTCAAGAAG
AATCTACTGACATTCCTGCAGGAGGTATGCCTCGTTCTATTGATATTGTTTGTAGAGGTG
AAGTTGTTGACACCGCTAAGCCTGGTGATAAATGTATTTTCACTGGTTATTTAATTGTTG
TTCCTGATATAGCAGCTCTTACTAAACCAGGTGAAAAAACTGAAATGGGTATTAAATCTG
ATGCCGTTAGAGTCAAAGGAGAAGGAAATAATGATGGTATTACTGGTCTCTCTCAACTAG
GTCAAAGAGATTTGAACTACAGACTTGTTTTCTTAGCTATTAACATTGAAGCAAAAAAGA
GTAGATTCAACTTATGGAATTAAGATGAAGAAGAAAATCAGGTAATTAATCAAAATTTAA
CATTATTTATATTCATTTTAATAGAAAGAAAAGCAGCAATATAGATAGGGTTTTATTATA
GCAAAAATTAGAAAAGATTTAAAGTCTTTACTTTACTTTAGTTTTTTTGTTTGTCTGAGA
TAAGAAAAAAAATTAAAAACAAAAAATATTTGCAATAAATTTTCAAATTATTAAATAAAA
TTTTTATTTTTTAGTGAAATTTTGTTATTAATAAATAATTTATAATATTTGTAATAGGAT
TTAACTGAAGAAGAAGAAAGACAAAAAATTATGGAAAATTTCTCTGAAAGAGAACTTGAA
GACATTTTTAAAATAAGCAGAAGTTCTAATGTTTATGAAAGATTAGCATCTAGTTTGTGT
CCTACTGTACATGGTCACTTGGAAGTTAAAAAGGGTATTTTACTCATGCTTTTTGGTGGT
GTCAACAAAAAAACAGAAGAAGGTATTAACTTGAGAGGTGATATCAACATTTGCATGGTA
GGTGATCCATCTACTGCTAAGTCTCAATTCCTTAAATATGTTAATAAGCTTATTCCTCGT
TCAGTCTATACTTCTGGTAAAGCATCAACATCTGCTGGTTTGACTGCAAGTGTTTCTAAA
GATCCTGAAACTGGAGAAAATTGCATTGAAGCTGGTGCTTTGATGCTTTCTGACTAAGGT
ATTTGCTGTATCGATGAATTTGATAAGATGGATAAAAGAGATTAAGTCGCCATCCACGAA
GCTATGGAACAATAAACAATTTCTATTTCAAAGGCAGGTATTCAAGCTACCTTGAATTCA
AGAGCCAGTATTTTAGCTGCTGCAAACCCTGTTTTTGGTAGATACGATAAATCCAAGGGT
TTAAAATACAACTTAGATATAAGCGCTCCCATTCTTTCTCGTTTCGATTTATTCTTTGTC
ATTTTGGATGAGTGCAACGAATAATCAGATAGAATGATTGCATAACATATTGTTAATATT
CATTAAAGCTGTGGAAGAAATATCAATCCTGAAATCAGTACTGAAGATTTGTCTAAGTAT
ATACGTTTTGCTAGAACTATAAAGCCAATTTTCACTCGTGAAGCTGCCCTCGAATTGCAA
AAATGCTATGTAAAACTTAGATAAAATGATTCAAGCTCTTAAAATACTTCATACAGAATT
ACAGTCAGACAGCTTGAATCTCTTATTAGATTAAGTGAAGCTTTGGCTAGAGTTCACATT
CAATCAGAAGTTACTGCTGAATTTGTATAGGAAGCCGCAAGATTACTCAGCAATTCTATT
CTTAAAATAGAAAAGGGATAATTGGACATCTAAGATGAAGAAGAGCAAAAGATAGACCTC
AACTAATAAAAAGAATAAGGCTAAAACATTATTGTAAAAACAATTAATTAAATTTTTATA
CCTTATTTACTAATTAATCATTTTAATTTTAAAAAAAATAGTAAGAAGATATTGAAAAAA
AACAACAATAATAAAGAAAGAAGGAAGGTAAAATCTCAATTACTTATGAGGAATACTTAA
ACATGAGAAAGATAATCATTCAAACAGTCAAAGATTTAGAAATAGAAGATAGTCTTAGAG
TTTCCACAGAAGGAGAAGACGGAATGGAAGTTGAAAGACAAAGTAAATTAATTTTATTTA
TTTATTACCTCCAAATACTAAATTGAATTTTATTAATAAATTAGATGGTTTCGAATAAAG
AGTTATTATAGAATAAATTCTTAAGCAATTATTAGAAAATGACCTTATCCAAACAGAAGA
AGATGCTACTAAATTAAAAAAAATATATTCTCAAATTATTAAAAAGTTAGTAGATGTAGA
CTAAGTTTTAATTGTTGTCGAAGAGGCCTCAAATTTAGACGAACGTAGATTATAACTTCA
TGCTAACTACTGCGAACCTAGTTGA