Identifiers and Description

Gene Model Identifier

TTHERM_00069420

Standard Name

MCM5 (DNA replication licensing factor MCM5)

Aliases

PreTt13232 | 4.m00631 | 3707.m00267

Description

Component of the Mcm2-7 complex involved in DNA replication

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00493 ) MCM2/3/5 family
  • ( PF00004 ) ATPase, AAA family
  • ( TIGR00264 ) alpha-NAC homolog
  • ( TIGR00368 ) Mg chelatase homolog
  • ( PF01926 ) GTPase of unknown function
  • ( PF01078 ) Magnesium chelatase, subunit ChlI
  • ( PF05286 ) Fertility inhibition protein (FINO)
  • ( PF07726 ) ATPase family associated with various
  • ( PF07728 ) ATPase family associated with various

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00069420

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_214790
Tetrahymena borealisEI9_02143.19.997093137033517e-262MCM2/3/5 family protein (729 a
a)
OxytrichaContig1884.0.g109.997093137033517e-262MCM2/3/5 family
SGDYLR274W9.997093137033517e-262MCM5 Component of the hexameri
c MCM complex, which is import
ant for priming origins of DNA
replication in G1 and becomes
an active ATP-dependent helic
ase that promotes DNA melting
and elongation when activated
by Cdc7p-Dbf4p in S-phase
DictyBaseDDB_G02929587.000463540624081e-176mcm5 on chromosome: 6 position
2121500 to 2123946
WormBaseWBGene000031571.9993181170755286e-174locus:mcm-5 DNA replication
licensing factor mcm-5 statu
s:Confirmed UniProt:Q21902
protein_id:CAA90765.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00069420(coding)
ATGTACTAAGGAGAGTAAATTAGTTATACATACTAAAATTTGGTTTAAGATGAACCCTAC
AATCAAATCGATAACATGCCTCATGTACCCTAACAAGTCTAAGAAGGTTACAAAAGATTC
TTCTCTGAATTCTTACTCAAGAATCAGAAAGTTTACATTGAAAAAATGAAATAAGCTGTC
GAATCACGTAAGAAATGCTTCGAGCTTGACTTAGAAGATTTGTAATCTTACAACTCTGAC
CATTACTAGCTTCTTATTTAAAAGCCAAACGATTATCTTCCTCTTCTTGAAAAGGCTGCT
TCTGAAGCTTTCTACACAATTACTAATAACCGTAGCAACTTCTAAGTTTTTCTTATCAGT
ACTTAAGACCCTAAGAATCTTCGTGATATTAAGGCTTCTTCTATCTCGAAGCTTATCACT
GTCTCTGGTATTATCACTCAAGCAACTAGACCTTATATTCGTAGTAAAATTTTATACGTA
GAGTGCTCTAAATGCCATCATTAATTGAGTTTAGAAGTTAGCTAAGGTTTGGGTTCAGTA
TCAATTCCTCCTTACTGTAAGAATCCTAACTAAAGTAACGAAAAGTGCCCTGTTGACAGT
TATGTTGTAATTCCAGAAAAGTGCACTCTTATAGATTAGCAAAGAATGAAACTTCAAGAA
TCTCCTGAAGATATTCCTACTGGTGAAATTCCTCGTACTTTTTCTCTTTGTGCTGAACGC
TATTTGGTCAACAGACTTGCTCCAGGTACTCGTGTTGTTTTGACTGGTATTTACTAAGTC
TTAGAGAAAACTTCAATTTCTAACAAAACAATATCTTCTACCAACTCTAAGATAAACTAT
ATTCAAGTTGTTGGTTATAAACTCGAAGATGAAATTAAGAAAAGATCAAGAAGCTTTACT
ACCGAAGAAGAAGAGGCTTTCTAAACTCTTTCCAAAGATCCTAAAATCTTTGAAAAAATA
GGATAATCCATAGCTCCTGCAATATTCGGTTTTGATGATATTAAATAAGCAATAGCATGT
CTTTTATTCGGTGGTTCTAAAAAGATTTTATAAGACGGAATAAGACTTAGAGGAGACATT
AATGTCTTATTGATCGGTGATCCTAGTACTGGTAAATCTTAATTTTTGAAATTCGTCCAA
AGAATAGCCCCTAATGCAGTATATACATCCGGTAAAGGTTCTTCTGCTAGTGGTTTAACA
GCTAGTATTACAAGAGACCCTCTTACTGGTGAATTTTAAATTGAAGGTGGTGCCATGGTT
TTAGCTGATGGTGGAGTTGTGTGTATTGATGAATTTGATAAGATGCGTCCTGAAGACAGA
GTAGCAATTCATGAAGCTATGGAACAATAAACTATCAGTATTGCTAAGGCTGGTATAACA
ACTCGTCTAAACTCTCGTTGCTCTGTTCTAGCTGCTGCCAATCCTATTTTTGGTTCTTAC
AACGACTTGAAGACCATTGAAGATTAAATTGAACTCCAGACTACCATTCTTTCTCGTTTT
GATACAATTTTCGTTGTTAGAGATCCTAAAACCTAGGAACATGATTAACGTCTCGCTGAA
CATGTTCTTAACTTGCACATGATGAATAACTAAAAGAACGGAGGAAGCATTAATGCTGCT
GTCATGGAATAGGAAATGCTTGAATAAAAAGGAGTTGAAATTGAGTTAAATCTCTTAAGA
AAATACATCTCATACGCTCGTGCTAAAATCCATCCTCGTTTGACTGAAAGATCTGCTTAA
AAAATTTAAAATTTATACGTTGAAGATAGAAAGCAATCAAATCAAGGTCACTCATCTAAG
AAGCACCATATTCCTATAACAGTTCGTTAATTAGAAGCCATTATTCGTTTGAGTGAATCA
ATAGCTAAGATTTAATTGAGTGAAGAAGTTACTGATGAACATATCAATAAAGCACATGAA
CTCTTCTAAAATTCTACAATGAACGCCATATAAAACGGTAAAGAATTAGGTTTAGAACTT
CCTTAAGAATTATAGTCTCTATGCTTTAAAATCGAAGAATCTATTCGTCACAATATTCCA
GTAAATGGAAGATACGATTTCACTTCTCTTAAAGATAAATTGTTTTCTAAATTTAACAAT
GCTCGTGCAGTAGATTATGCCTTTTATAAGTTGATTAAAGATGGAGAGTTGCAATAAGTT
GAAGGAAACAGATTTATTGTTCGTAAGAAGTGA


>TTHERM_00069420(protein)
MYQGEQISYTYQNLVQDEPYNQIDNMPHVPQQVQEGYKRFFSEFLLKNQKVYIEKMKQAV
ESRKKCFELDLEDLQSYNSDHYQLLIQKPNDYLPLLEKAASEAFYTITNNRSNFQVFLIS
TQDPKNLRDIKASSISKLITVSGIITQATRPYIRSKILYVECSKCHHQLSLEVSQGLGSV
SIPPYCKNPNQSNEKCPVDSYVVIPEKCTLIDQQRMKLQESPEDIPTGEIPRTFSLCAER
YLVNRLAPGTRVVLTGIYQVLEKTSISNKTISSTNSKINYIQVVGYKLEDEIKKRSRSFT
TEEEEAFQTLSKDPKIFEKIGQSIAPAIFGFDDIKQAIACLLFGGSKKILQDGIRLRGDI
NVLLIGDPSTGKSQFLKFVQRIAPNAVYTSGKGSSASGLTASITRDPLTGEFQIEGGAMV
LADGGVVCIDEFDKMRPEDRVAIHEAMEQQTISIAKAGITTRLNSRCSVLAAANPIFGSY
NDLKTIEDQIELQTTILSRFDTIFVVRDPKTQEHDQRLAEHVLNLHMMNNQKNGGSINAA
VMEQEMLEQKGVEIELNLLRKYISYARAKIHPRLTERSAQKIQNLYVEDRKQSNQGHSSK
KHHIPITVRQLEAIIRLSESIAKIQLSEEVTDEHINKAHELFQNSTMNAIQNGKELGLEL
PQELQSLCFKIEESIRHNIPVNGRYDFTSLKDKLFSKFNNARAVDYAFYKLIKDGELQQV
EGNRFIVRKK


>TTHERM_00069420(gene)
ATGTACTAAGGAGAGTAAATTAGTTATACATACTAAAATTTGGTTTAAGATGAACCCTAC
AATCAAATCGATAACATGCCTCATGTACCCTAACAAGTCTAAGAAGGTTACAAAAGATTC
TTCTCTGAATTCTTACTCAAGAATCAGAAAGTTTACATTGAAAAAATGAAATAAGCTGTC
GAATCACGTAAGAAATGCTTCGAGCTTGACTTAGAAGATTTGTAATCTTACAACTCTGAC
CATTACTAGCTTCTTATTTAAAAGCCAAACGATTATCTTCCTCTTCTTGAAAAGGCTGCT
TCTGAAGCTTTCTACACAATTACTAATAACCGTAGCAACTTCTAAGTTTTTCTTATCAGT
ACTTAAGACCCTAAGAATCTTCGTGATATTAAGGCTTCTTCTATCTCGAAGCTTATCACT
GTCTCTGGTATTATCACTCAAGTAATTTTTGCATGCTTCACATTTATCATATATCATCTC
TTTTAACATTTTGAAAATCGCTTTTATTAATAAAACTAATTATCATAATAATAAAATAGG
CAACTAGACCTTATATTCGTAGTAAAATTTTATACGTAGAGTGCTCTAAATGCCATCATT
AATTGAGTTTAGAAGTTAGCTAAGGTTTGGGTTCAGTATCAATTCCTCCTTACTGTAAGA
ATCCTAACTAAAGTAACGAAAAGTGCCCTGTTGACAGTTATGTTGTAATTCCAGAAAAGT
GCACTCTTATAGATTAGCAAAGAATGAAACTTCAAGAATCTCCTGAAGATATTCCTACTG
GTGAAATTCCTCGTACTTTTTCTCTTTGTGCTGAACGCTATTTGGTCAACAGACTTGCTC
CAGGTACTCGTGTTGTTTTGACTGGTATTTACTAAGTCTTAGAGAAAACTTCAATTTCTA
ACAAAACAATATCTTCTACCAACTCTAAGATAAACTATATTCAAGTTGTTGGTTATAAAC
TCGAAGATGAAATTAAGAAAAGATCAAGAAGCTTTACTACCGAAGAAGAAGAGGCTTTCT
AAACTCTTTCCAAAGATCCTAAAATCTTTGAAAAAATAGGATAATCCATAGCTCCTGCAA
TATTCGGTTTTGATGATATTAAATAAGCAATAGCATGTCTTTTATTCGGTGGTTCTAAAA
AGATTTTATAAGACGGAATAAGACTTAGAGGAGACATTAATGTCTTATTGGTAATTAATT
TTTAAATGTTTTAATCTAAATTTTAAACAGTCAAGCAAAAGCAAACTTTTTGAAGATGAA
AATAGCAAAAATATTTTGAAAATTTCCATGCAATAAAAACTTTATTTATTAAATTTAAAT
TTATAAAATAGATCGGTGATCCTAGTACTGGTAAATCTTAATTTTTGAAATTCGTCCAAA
GAATAGCCCCTAATGCAGTATATACATCCGGTAAAGGTTCTTCTGCTAGTGGTTTAACAG
CTAGTATTACAAGAGACCCTCTTACTGGTGAATTTTAAATTGAAGGTGGTGCCATGGTTT
TAGCTGATGGTGGAGTTGTGTGTATTGATGAATTTGATAAGATGCGTCCTGAAGACAGAG
TAGCAATTCATGAAGCTATGGAACAATAAACTATCAGTATTGCTAAGGCTGGTATAACAA
CTCGTCTAAACTCTCGTTGCTCTGTTCTAGCTGCTGCCAATCCTATTTTTGGTTCTTACA
ACGACTTGAAGACCATTGAAGATTAAATTGAACTCCAGACTACCATTCTTTCTCGTTTTG
ATACAATTTTCGTTGTTAGAGATCCTAAAACCTAGGAACATGATTAACGTCTCGCTGAAC
ATGTTCTTAACTTGCACATGATGAATAACTAAAAGAACGGAGGAAGCATTAATGCTGCTG
TCATGGAATAGGAAATGCTTGAATAAAAAGGAGTTGAAATTGAGTTAAATCTCTTAAGAA
AATACATCTCATACGCTCGTGCTAAAATCCATCCTCGTTTGACTGAAAGATCTGCTTAAA
AAATTTAAAATTTATACGTTGAAGATAGAAAGCAATCAAATCAAGGTCACTCATCTAAGA
AGCACCATATTCCTATAACAGTTCGTTAATTAGAAGCCATTATTCGTTTGAGTGAATCAA
TAGCTAAGATTTAATTGAGTGAAGAAGTTACTGATGAACATATCAATAAAGCACATGAAC
TCTTCTAAAATTCTACAATGAACGCCATATAAAACGGTAAAGAATTAGGTTTAGAACTTC
CTTAAGAATTATAGTCTCTATGCTTTAAAATCGAAGAATCTATTCGTCACAATATTCCAG
TAAATGGAAGATACGATTTCACTTCTCTTAAAGATAAATTGTTTTCTAAATTTAACAATG
CTCGTGCAGTAGATTATGCCTTTTATAAGTTGATTAAAGATGGAGAGTTGCAATAAGTTG
AAGGAAACAGATTTATTGTTCGTAAGAAGTGA