Identifiers and Description

Gene Model Identifier

TTHERM_00277550

Standard Name

MCM4 (DNA replication licensing factor MCM4)

Aliases

PreTt04796 | 25.m00260 | 3694.m00047

Description

Component of the Mcm2-7 complex involved in DNA replication

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00493 ) MCM2/3/5 family
  • ( PF08792 ) A2L zinc ribbon domain
  • ( TIGR00368 ) Mg chelatase homolog
  • ( PF01078 ) Magnesium chelatase, subunit ChlI
  • ( PF05581 ) Vibrio chemotaxis protein N terminus
  • ( PF06835 ) Protein of unknown function (DUF1239)
  • ( PF07946 ) Protein of unknown function (DUF1682)
  • ( PF07724 ) ATPase family associated with various
  • ( PF07726 ) ATPase family associated with various
  • ( PF07728 ) ATPase family associated with various

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00277550

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_16560
WormBaseWBGene000031569.997093137033517e-262locus:mcm-4 status:Confirmed
UniProt:Q95XQ8 protein_id
:CCD69913.1
Tetrahymena borealisEI9_08908.19.997093137033517e-262MCM2/3/5 family protein (806 a
a)
DictyBaseDDB_G02756239.997093137033517e-262mcm4 on chromosome: 2 position
5936245 to 5938905
OxytrichaContig21940.0.g549.997093137033517e-262MCM2/3/5 family
SGDYPR019W9.997093137033517e-262MCM4 Essential helicase compon
ent of heterohexameric MCM2-7
complexes which bind pre-repli
cation complexes on DNA and me
lt DNA prior to replication; f
orms an Mcm4p-6p-7p subcomplex
; shows nuclear accumulation i
n G1; homolog of S. pombe Cdc2
1p

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00277550(coding)
ATGAATCAATCTGTTTCTGGCGAGTAAGGAAAGCAAACTCCTAACACTTCTTTTCAACGT
AGACATTTGTCTCAAAGCATCGGAGGAAACTAATCTTAAAGAATCCTCACCTAACCCTCA
TCTTTCATGCAATCTCCTATGTAGGATGGAACTGCAACTCTTTCTGGTGAAACTGGATAC
ATAAACTGGGGAACAAATATTAATACATAAGAATGTAGTAACAAATTCGAAAAGTTCTTG
TTAGAATTCAAGGCTATTCCTTCTGATGATCATGACATGTTAGATGAAAACGCTAGTGAA
GTTAACATTTATGTTGAAAAATTCAATTAAATGGCTGCTCTTGAATAATACATATTGACA
TTTGATGGCTAACATCTATTGCAGTTTGATAAGATTCTCTACTACCAACTTATTTTCTTC
CCTGCTGAAGTTATTCAAATATTCGATAAAGTAGCACAATCCATTTTTAGAGAACGTTTT
GCTTAGAATGAAACTCAAGTTGAAAAGTCAAACTCAGTCTTAGTTGCTGTAGTCAATATT
AATAAAAGTACCTAACTTAGAGATTTGCGTCATAAGGATATCAACCGTTTAGTTTCCATC
AAGTGTATTGTAATTAGAGTATCAGATATCTATCCTGAAATGAAGATGGCTGTTTTCAAG
TGCAGTAGATGCAGCCATTCAGTTATTGTACCTCTTGAAAGAGCTCATGTTGATGAACCT
AATGATTGCGAAAGTTGTCACACTAAAAACTCTTTCATGATTCAACATAATTTATCTCAC
TTTACTGATAAGTAGTATATAAAGATCTAAGAATTACCAGAAAAAGTGAGGGAAGGTGAA
ACTCCTCAAACTGCTACTTTGATGGCTTATGACAATAATTTAGTTGATCAAGTTAAACCT
GGTGACAGAGTCGAAGTCGTTGGTGTGTTTAGAGCAGCAGGAGTAAGAAAGAATAAAAAT
ATAAGAACCTTGAGATCCGTCTATAACACTTATATCGATGTCGTCTCATACTCTCTTTTA
AGCAAGCAAAAGTTATAAGAAGAAAAAATCAATTTTTCCGAAGAAACCAAAAGAAAGCTT
TAAGAAATTGCTGACAGTGAAAATGTTTATGATAAACTCATTAAATCAGTAGCACCATCT
ATTTGGGAAAATACTGATGTTAAGAGAGGTCTTCTTTGTCAACTTTTCGGTGGTAGTGTT
AAGACTATTCACGATGCTAAAGACAGCAGAACTAGAGCAGAAATCAATTGCTTATTGGTT
GGTGATCCTTCTGTTGCTAAATCCCAAATGCTTAAATACGTTCACAACTTAGTACCCAGA
GGTATTTACACATCTGGTAAAGGTTCTTCTGCAGTAGGTTTGACTGCATACGTAACCAGA
GATCCTGATACTAAAGAAATAGTTCTTGAAAGTGGTGCACTAGTACTTAGTGATCTAGGT
ATTTGTTGTATTGATGAGTTTGACAAGATGGATGAAAATACAAGAACTATTTTACACGAA
GCTATGGAATAATAATCTATTTCTATTGCAAAGGCAGGTATTGTTGCTACTTTGAACACA
AGAACTGCAATTTTGGCTGGTGCTAATCCAATAGATTCCCGTTATGACCCCAAGAAATCA
GTCATCGATAATATAAATCTCCCTCCTTCTTTACTTTCTAGATTTGATTTGATCTATATT
TTATTAGATAATCATGATGAAAGAAAAGATATTTAATTAGCTTCTCATATCTTAAAGCTT
TTCTCTAATTCAAGCTAGCATAGACTTACTCAAGGATAAAATAGTGGATACTCTGATATT
GATATTATTGATAAAGATACACTTATCAAGTATATTGCATATGCTCGTTAAGAAATTCAT
CCCAAACTTACTTAGGAAGCTGCTGACAGACTAGTTTAAGGATATGTTGACATGAGAAAG
GTTGGTTTAAGCAATAAAGTTATTACTTCAACTACCCGTCAACTTGAATCATTAATTCGT
ATTTCAGAATCTTTGGCAAAAATGAAACTAAGTGATTAGGTTACAGTTGAAAATGTAGAA
GAAGCTATCAGATTAATGAAGGTTGCCACACAAAGTGCTGCTACTGACCCTACAACTGGT
CTAATTGATATGGATATGCTTGCAACTGGTATATCAGCTTAAAAGAAATAGAGAATTTTA
GACTTATCAGATTAAATCCGTGGTTTGGCTAAATCCAATTAAGGTGTATTCAAAAAGGGT
ATTTCAGTCCATGAATTGCGTTAATTGTTAGCAAACAAAGAAAATATATAAATAATCAAG
ATCGATGAATAAGAAGTTATATCAGCAGTAAATATGTTAGTAGAAGAAAATTTACTCCTT
AAGATGGGTAATAATAAGAATCCAATTATAAAATTATAAAGTATCGAAGAGTGA


>TTHERM_00277550(protein)
MNQSVSGEQGKQTPNTSFQRRHLSQSIGGNQSQRILTQPSSFMQSPMQDGTATLSGETGY
INWGTNINTQECSNKFEKFLLEFKAIPSDDHDMLDENASEVNIYVEKFNQMAALEQYILT
FDGQHLLQFDKILYYQLIFFPAEVIQIFDKVAQSIFRERFAQNETQVEKSNSVLVAVVNI
NKSTQLRDLRHKDINRLVSIKCIVIRVSDIYPEMKMAVFKCSRCSHSVIVPLERAHVDEP
NDCESCHTKNSFMIQHNLSHFTDKQYIKIQELPEKVREGETPQTATLMAYDNNLVDQVKP
GDRVEVVGVFRAAGVRKNKNIRTLRSVYNTYIDVVSYSLLSKQKLQEEKINFSEETKRKL
QEIADSENVYDKLIKSVAPSIWENTDVKRGLLCQLFGGSVKTIHDAKDSRTRAEINCLLV
GDPSVAKSQMLKYVHNLVPRGIYTSGKGSSAVGLTAYVTRDPDTKEIVLESGALVLSDLG
ICCIDEFDKMDENTRTILHEAMEQQSISIAKAGIVATLNTRTAILAGANPIDSRYDPKKS
VIDNINLPPSLLSRFDLIYILLDNHDERKDIQLASHILKLFSNSSQHRLTQGQNSGYSDI
DIIDKDTLIKYIAYARQEIHPKLTQEAADRLVQGYVDMRKVGLSNKVITSTTRQLESLIR
ISESLAKMKLSDQVTVENVEEAIRLMKVATQSAATDPTTGLIDMDMLATGISAQKKQRIL
DLSDQIRGLAKSNQGVFKKGISVHELRQLLANKENIQIIKIDEQEVISAVNMLVEENLLL
KMGNNKNPIIKLQSIEE


>TTHERM_00277550(gene)
ATGAATCAATCTGTTTCTGGCGAGTAAGGAAAGCAAACTCCTAACACTTCTTTTCAACGT
AGACATTTGTCTCAAAGCATCGGAGGAAACTAATCTTAAAGAATCCTCACCTAACCCTCA
TCTTTCATGCAATCTCCTATGTAGGATGGAACTGCAACTCTTTCTGGTGAAACTGGATAC
ATAAACTGGGGAACAAATATTAATACATAAGAATGTAGTAACAAATTCGAAAAGTTCTTG
TTAGAATTCAAGGCTATTCCTTCTGATGATCATGACATGTTAGATGAAAACGCTAGTGAA
GTTAACATTTATGTTGAAAAATTCAATTAAATGGCTGCTCTTGAATAATACATATTGACA
TTTGATGGCTAACATCTATTGCAGTTTGATAAGATTCTCTACTACCAACTTATTTTCTTC
CCTGCTGAAGTTATTCAAATATTCGATAAAGTAGCACAATCCATTTTTAGAGAACGTTTT
GCTTAGAATGAAACTCAAGTTGAAAAGTCAAACTCAGTCTTAGTTGCTGTAGTCAATATT
AATAAAAGTACCTAACTTAGAGATTTGCGTCATAAGGATATCAACCGTTTAGTTTCCATC
AAGTGTATTGTAATTAGGTAAAAAAATTAATTTATATTTTCATTTTCTTTTTTTTTTTCA
AAGTGCTCTTTAAAACAAATTTTATAACACTAAAATGTTATTTTGTTATAGGATGTTAAA
TAAGCTAAAAAACATTATGAATTTAAAGAAAAGCATTTAAAGTGATATAATGAATAAATG
ATTGAAATCTATCAACATTTTATTTTTACCTTTTTGAAATGGCAAAAAGATATTTTTTTA
TTTAAAGAAATAAAAAGGATATTTTTTTAAGTTGATAGGAGCGAAAATTTTTTAAAAATT
GCAAAAATAAATATGGCAAAAATATTTGTTAACATTGAACTAAAATATAAAATAGAGTAT
CAGATATCTATCCTGAAATGAAGATGGCTGTTTTCAAGTGCAGTAGATGCAGCCATTCAG
TTATTGTACCTCTTGAAAGAGCTCATGTTGATGAACCTAATGATTGCGAAAGTTGTCACA
CTAAAAACTCTTTCATGATTCAACATAATTTATCTCACTTTACTGATAAGTAGTATATAA
AGATCTAAGAATTACCAGAAAAAGTGAGGGAAGGTGAAACTCCTCAAGTAAAAACATCAT
TTTAATTATTTAGTTTTAATCTAAGTTATTTTAATATTAAACAATTAGACTGCTACTTTG
ATGGCTTATGACAATAATTTAGTTGATCAAGTTAAACCTGGTGACAGAGTCGAAGTCGTT
GGTGTGTTTAGAGCAGCAGGAGTAAGAAAGAATAAAAATATAAGAACCTTGAGATCCGTC
TATAACACTTATATCGATGTCGTCTCATACTCTCTTTTAAGCAAGCAAAAGTTATAAGAA
GAAAAAATCAATTTTTCCGAAGAAACCAAAAGAAAGCTTTAAGAAATTGCTGACAGTGAA
AATGTTTATGATAAACTCATTAAATCAGTAGCACCATCTATTTGGGAAAATACTGATGTT
AAGAGAGGTCTTCTTTGTCAACTTTTCGGTGGTAGTGTTAAGACTATTCACGATGCTAAA
GACAGCAGAACTAGAGCAGAAATCAATTGCTTATTGGTTGGTGATCCTTCTGTTGCTAAA
TCCCAAATGCTTAAATACGTTCACAACTTAGTACCCAGAGGTATTTACACATCTGGTAAA
GGTTCTTCTGCAGTAGGTTTGACTGCATACGTAACCAGAGATCCTGATACTAAAGAAATA
GTTCTTGAAAGTGGTGCACTAGTACTTAGTGATCTAGGTATTTGTTGTATTGATGAGTTT
GACAAGATGGATGAAAATACAAGGTATTGCATTATTTCTTTAAATAATAAAAGGACCAAA
TGACAATTAAATCTTTTAAAGCAAATATTATTTAAAATAAGATATAGCATTTAGCAATTA
AAAAAGCAATAATTAGAAGATTTTTTTCAAGTTTTTATAACACATATTTTTTAATTTAAA
TAGAACTATTTTACACGAAGCTATGGAATAATAATCTATTTCTATTGCAAAGGCAGGTAT
TGTTGCTACTTTGAACACAAGAACTGCAATTTTGGCTGGTGCTAATCCAATAGATTCCCG
TTATGACCCCAAGAAATCAGTCATCGATAATATAAATCTCCCTCCTTCTTTACTTTCTAG
ATTTGATTTGATCTATATTTTATTAGATAATCATGATGAAAGAAAAGATATTTAATTAGC
TTCTCATATCTTAAAGCTTTTCTCTAATTCAAGCTAGCATAGACTTACTCAAGGATAAAA
TAGTGGATACTCTGATATTGATATTATTGATAAAGATACACTTATCAAGTATATTGCATA
TGCTCGTTAAGAAATTCATCCCAAACTTACTTAGGAAGCTGCTGACAGACTAGTTTAAGG
ATATGTTGACATGAGAAAGGTTGGTTTAAGCAATAAAGTTATTACTTCAACTACCCGTCA
ACTTGAATCATTAATTCGTATTTCAGAATCTTTGGCAAAAATGAAACTAAGTGATTAGGT
TACAGTTGAAAATGTAGAAGAAGCTATCAGATTAATGAAGGTTGCCACACAAAGTGCTGC
TACTGACCCTACAACTGGTCTAATTGATATGGATATGCTTGCAACTGGTATATCAGCTTA
AAAGAAATAGAGAATTTTAGACTTATCAGATTAAATCCGTGGTTTGGCTAAATCCAATTA
AGGTGTATTCAAAAAGGGTATTTCAGTCCATGAATTGCGTTAATTGTTAGCAAACAAAGA
AAATATATAAATAATCAAGATCGATGAATAAGAAGTTATATCAGCAGTAAATATGTTAGT
AGAAGAAAATTTACTCCTTAAGATGGGTAATAATAAGAATCCAATTATAAAATTATAAAG
TATCGAAGAGTGA