Identifiers and Description

Gene Model Identifier

TTHERM_00092850

Standard Name

MCM3 (DNA replication licensing factor MCM3)

Aliases

PreTt16539 | 6.m00613 | 3836.m02199

Description

Component of the Mcm2-7 complex involved in DNA replication

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00493 ) MCM2/3/5 family
  • ( PF01078 ) Magnesium chelatase, subunit ChlI
  • ( PF07726 ) ATPase family associated with various
  • ( PF07728 ) ATPase family associated with various

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00092850

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_188470
Tetrahymena borealisEI9_02544.19.997093137033517e-262MCM2/3/5 family protein (861 a
a)
DictyBaseDDB_G02803099.997093137033517e-262mcm3 on chromosome: 3 position
3235987 to 3238812
OxytrichaContig14518.0.0.g1159.997093137033517e-262hypothetical protein
WormBaseWBGene000031559.999763672313033e-177locus:mcm-3 status:Confirmed
UniProt:Q9XVR7 protein_id
:CAB02770.1
SGDYEL032W7.002698837743091e-168MCM3 Protein involved in DNA r
eplication; component of the M
cm2-7 hexameric complex that b
inds chromatin as a part of th
e pre-replicative complex

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00092850(coding)
ATGGAAATAGAAAATACTAATCAAATTGACACTCGCTGGTAAGAGCACCAGAACTTCTTT
GGACAATATTTAGCAAACTCCACTAATACAGATGCCATTAATAGAATGTTAACCAATAAT
GAGACACGTTTAGTGATCAATTTAGATGATATTCGTTAGAATCACAACCCTTAAATAGCT
GATGATATCATTAGTTACCCTTAAAAGGCAATCTCTGCCCTTAGAGGAACTCTCAATAAA
ATTATCGATAATATTGACCATGACGGGCTTGTGAAAAAGAAAAAGATGTAAGATATCACT
GAAAAAGTTAAAGTTTATCAAATTGCTTTTAATGGAAATATGGGTAGAAACCATGTAACT
CCTAGAGGTTTGAACTGTTCACTCATAAATAAATTAGTTTGCATCGATGGTATTGTAACT
AGAATGTCAGTCAATAGATCAAAGTTAATTAGAAGTGTCCATTATTGTGAAGAAATATTG
CAAGGTGGTCCTATTAAAGATTACGAAGATGTTTATGATTTAGGTGCCACAACATCTCTT
AATCCAAATAATACAATTCCCAAAAGTCATGAACAACATCCCTTAAGCTTAGAGTATGGC
TATTCTAAATTCAAAGACTTCTAGACTATTATTGTTTAGGAACTTCCTGAAAATGCCCCT
AATGGTTTATTACCTCGTAGCATTGATGTTGTGCTTGAAGAAGATTTAGTTGGATCAGTT
AAACCTGGAGATAGAGTTAGAATTTATGGTGTTTATAAATGCATTAAAAGTGAATAAACC
AAATCAACTGGTATTATGAGAAGTGTCTTAGTTTGCACAAGCATTGGCTAACTTTCATAA
GAAAATGATGATGTTTAATTGACAACTGAAGATCTTTAATATATTAAGAAAATCTCAAAG
AGAAAAGATCTCGTTGATATTTTTGTTAACTCAATTGCTCCTTCTATTTATGGACACCAA
TAAATCAAAAAGGCATTGTTGCTCTAATTACTTGGTGGTACTGAAAAAACTGTTGGACAA
GGTACTCACTTAAGAGGTGATATAAATATCATGATGATTGGTGATCCTTCAACTGCAAAA
TCCCAAGTTCTTCGTTACATGCTTGCTACTGCCCCATTAGCTTTAAACACTACTGGTCGT
GGTTCTTCAGGTGTTGGTCTTACTGCTGCTGTTAAAACCGATAGAGAAACAGGCGAAAGA
CATTTGGAAGCTGGTGCAATGGTGTTAGCTGATAAGGGTGTTGTCTGTATTGATGAATTT
GATAAGATGAGTGAAGAAGATAGAGTTGCTATCCACGAAGTTATGGAATAATAAACTGTT
ACTATTGCAAAAGCAGGTATTCACTGCAGTTTAAATGCTCGTTGTTCTGTCCTTGCTGCT
GCTAATCCCATTTACGGAGAATATCATAGAGACTAGACTCCCACTAAGAATATTGGTTTA
CCTGATTCTCTTCTTTCTCGTTTTGATTTGTTATTCATCGTCCTTGATGAAAAGGATCCC
GATATTGATCGTCTTATTGCTGAACGTGTTACTCGTAACCATCGTTATCGTCCCGAAAAC
TACGAAATTATAAACTAGCTATCCCAATTCTAAGGTGACGAAAATGATGAATACATAATA
GAACCCACTGTAGCAGGAGACGCCAACGAAAACAAAGCTATCTTTGAAAAATATAACAAA
GTTTTACATGGAGATAAAAAGAAAGAAATATTAAACTAAAATTTCTTAAAAAAATACATT
GCTTATGCCAAAAAGACATTTAACTCTCCCAAATTATCTGATGAGTCCATCGAATATATT
AACTTGTATTACAATTAATTGAGATAAAAGAACTTCTAGGATTCTACTACTAACGGTGGT
GTTAAGGTTCTTCCAGTAACAACAAGAACTCTTGAAACTGTTATCAGATTGGCAACTGCA
TCTGCTAAACTTCGTTTATCTAAAAATATTGAAATTTCTGATTGCAGACTTGCTACTTCT
CTTCTTAACTATGCTCTTTTCAATAAAGAAGATGCAATTAGACCTGAGGAAGAAGAATTT
TATGAAGAAGACGAAGATTACAAATAAGATAGAAGACAAAATGGCAATAAAAAGGAAACC
TAACCAAAATCAGTTAAAAAGTAGACTAACACAACTGTTCAACCTCCAGTCCAGGTCACT
GAAAACAAAAGAGAAAGCAGAAGTGCTTCTAAAGCTATTGCTGCTGAATAACAAGCATAA
AAATCTACTACCCCCTTAAAGGAAAAACAAGATAAAAGAGAAATCAAAAATCAAATGAAG
AAAATAAGAATCGATGACGATGATGATGTTGATAAGGTTTTCAGCTAATAAATAATTGCT
TCAATTAAAATTACTGATGAATAGAAAAAGGCTATCTTCAAAATAGTATCTAAGCTTGCT
AAGGATAAAAGTATTACCAAGGATCAATTATGGAAACACATTTAAGGTAATTAAGACTTG
TCTAAGATTATTACCAGTTCGCCTATTTTAGACAGAGCCATTATAGAATTACAAGATGAT
GAAAAGATTTTCTACGATGCATCTAAATAAGAAATCTACCCTTATTGA


>TTHERM_00092850(protein)
MEIENTNQIDTRWQEHQNFFGQYLANSTNTDAINRMLTNNETRLVINLDDIRQNHNPQIA
DDIISYPQKAISALRGTLNKIIDNIDHDGLVKKKKMQDITEKVKVYQIAFNGNMGRNHVT
PRGLNCSLINKLVCIDGIVTRMSVNRSKLIRSVHYCEEILQGGPIKDYEDVYDLGATTSL
NPNNTIPKSHEQHPLSLEYGYSKFKDFQTIIVQELPENAPNGLLPRSIDVVLEEDLVGSV
KPGDRVRIYGVYKCIKSEQTKSTGIMRSVLVCTSIGQLSQENDDVQLTTEDLQYIKKISK
RKDLVDIFVNSIAPSIYGHQQIKKALLLQLLGGTEKTVGQGTHLRGDINIMMIGDPSTAK
SQVLRYMLATAPLALNTTGRGSSGVGLTAAVKTDRETGERHLEAGAMVLADKGVVCIDEF
DKMSEEDRVAIHEVMEQQTVTIAKAGIHCSLNARCSVLAAANPIYGEYHRDQTPTKNIGL
PDSLLSRFDLLFIVLDEKDPDIDRLIAERVTRNHRYRPENYEIINQLSQFQGDENDEYII
EPTVAGDANENKAIFEKYNKVLHGDKKKEILNQNFLKKYIAYAKKTFNSPKLSDESIEYI
NLYYNQLRQKNFQDSTTNGGVKVLPVTTRTLETVIRLATASAKLRLSKNIEISDCRLATS
LLNYALFNKEDAIRPEEEEFYEEDEDYKQDRRQNGNKKETQPKSVKKQTNTTVQPPVQVT
ENKRESRSASKAIAAEQQAQKSTTPLKEKQDKREIKNQMKKIRIDDDDDVDKVFSQQIIA
SIKITDEQKKAIFKIVSKLAKDKSITKDQLWKHIQGNQDLSKIITSSPILDRAIIELQDD
EKIFYDASKQEIYPY


>TTHERM_00092850(gene)
ATGGAAATAGAAAATACTAATCAAATTGACACTCGCTGGTAAGAGCACCAGAACTTCTTT
GGACAATATTTAGCAAACTCCACTAATACAGATGCCATTAATAGAATGTTAACCAATAAT
GAGACACGTTTAGTGATCAATTTAGATGATATTCGTTAGAATCACAACCCTTAAATAGCT
GATGATATCATTAGTTACCCTTAAAAGGCAATCTCTGCCCTTAGAGGAACTCTCAATAAA
ATTATCGATAATATTGACCATGACGGGCTTGTGAAAAAGTAATTTTATTAGTTTTTATTT
ACTTTTAAATGTGTTTACTAATTTTATAGAAGATTTGATTTATTCATTTTTGTTTTCTTT
AAACCTTGATGCATTCAAAAAAGAAATAATGAATCTGAATTTCTAACTTTTTTTTGTTCA
TAATAGGAAAAAGATGTAAGATATCACTGAAAAAGTTAAAGTTTATCAAATTGCTTTTAA
TGGAAATATGGGTAGAAACCATGTAACTCCTAGAGGTTTGAACTGTTCACTCATAAATAA
ATTAGTTTGCATCGATGGTATTGTAACTAGAATGTCAGTCAATAGATCAAAGTTAATTAG
AAGTGTCCATTATTGTGAAGAAATATTGCAAGGTGGTCCTATTAAAGATTACGAAGATGT
TTATGATTTAGGTGCCACAACATCTCTTAATCCAAATAATACAATTCCCAAAAGTCATGA
ACAACATCCCTTAAGCTTAGAGTATGGCTATTCTAAATTCAAAGACTTCTAGACTATTAT
TGTTTAGGAACTTCCTGAAAATGCCCCTAATGTAATTTTTTATTTGAATTTAAATTTTAA
GATAGATTTTGTTTTGAATTTGTTTGAATTTTATATATATGCTTACCATGTACTTAAAAT
AAAAAGGGTTTATTACCTCGTAGCATTGATGTTGTGCTTGAAGAAGATTTAGTTGGATCA
GTTAAACCTGGAGATAGAGTTAGAATTTATGGTGTTTATAAATGCATTAAAAGTGAATAA
ACCAAATCAACTGGTATTATGAGAAGTGTCTTAGTTTGCACAAGCATTGGCTAACTTTCA
TAAGAAAATGATGATGTTTAATTGACAACTGAAGATCTTTAATATATTAAGAAAATCTCA
AAGAGAAAAGATCTCGTTGATATTTTTGTTAACTCAATTGCTCCTTCTATTTATGGACAC
CAATAAATCAAAAAGGCATTGTTGCTCTAATTACTTGGTGGTACTGAAAAAACTGTTGGA
CAAGGTACTCACTTAAGAGGTGATATAAATATCATGATGATTGGTGATCCTTCAACTGCA
AAATCCCAAGTTCTTCGTTACATGCTTGCTACTGCCCCATTAGCTTTAAACACTACTGGT
CGTGGTTCTTCAGGTGTTGGTCTTACTGCTGCTGTTAAAACCGATAGAGAAACAGGTATA
TATTCATCTTTAAATTTCTTATCAAAAATCTAAAATAGAATAAAAAGGAAAAAGCAAAGA
TTCAAAAAAATTTGCAAAAAAATTCTATTTAAAAATTATCAATCAAAAATATATTTTTGT
TAATAAATTATTTTTGTAAATAGGCGAAAGACATTTGGAAGCTGGTGCAATGGTGTTAGC
TGATAAGGGTGTTGTCTGTATTGATGAATTTGATAAGATGAGTGAAGAAGATAGAGTTGC
TATCCACGAAGTTATGGAATAATAAACTGTTACTATTGCAAAAGCAGGTATTCACTGCAG
TTTAAATGCTCGTTGTTCTGTCCTTGCTGCTGCTAATCCCATTTACGGAGAATATCATAG
AGACTAGACTCCCACTAAGAATATTGGTTTACCTGATTCTCTTCTTTCTCGTTTTGATTT
GTTATTCATCGTCCTTGATGAAAAGGATCCCGATATTGATCGTCTTATTGCTGAACGTGT
TACTCGTAACCATCGTTATCGTCCCGAAAACTACGAAATTATAAACTAGCTATCCCAATT
CTAAGGTGACGAAAATGATGAATACATAATAGAACCCACTGTAGCAGGAGACGCCAACGA
AAACAAAGCTATCTTTGAAAAATATAACAAAGTTTTACATGGAGATAAAAAGAAAGAAAT
ATTAAACTAAAATTTCTTAAAAAAATACATTGCTTATGCCAAAAAGACATTTAACTCTCC
CAAATTATCTGATGAGTCCATCGAATATATTAACTTGTATTACAATTAATTGAGATAAAA
GAACTTCTAGGATTCTACTACTAACGGTGGTGTTAAGGTTCTTCCAGTAACAACAAGAAC
TCTTGAAACTGTTATCAGATTGGCAACTGCATCTGCTAAACTTCGTTTATCTAAAAATAT
TGAAATTTCTGATTGCAGACTTGCTACTTCTCTTCTTAACTATGCTCTTTTCAATAAAGA
AGATGCAATTAGACCTGAGGAAGAAGAATTTTATGAAGAAGACGAAGATTACAAATAAGA
TAGAAGACAAAATGGCAATAAAAAGGAAACCTAACCAAAATCAGTTAAAAAGTAGACTAA
CACAACTGTTCAACCTCCAGTCCAGGTCACTGAAAACAAAAGAGAAAGCAGAAGTGCTTC
TAAAGCTATTGCTGCTGAATAACAAGCATAAAAATCTACTACCCCCTTAAAGGAAAAACA
AGATAAAAGAGAAATCAAAAATCAAATGAAGAAAATAAGAATCGATGACGATGATGATGT
TGATAAGGTTTTCAGCTAATAAATAATTGCTTCAATTAAAATTACTGATGAATAGAAAAA
GGCTATCTTCAAAATAGTATCTAAGCTTGCTAAGGATAAAAGTATTACCAAGGATCAATT
ATGGAAACACATTTAAGGTAATTAAGACTTGTCTAAGATTATTACCAGTTCGCCTATTTT
AGACAGAGCCATTATAGAATTACAAGATGATGAAAAGATTTTCTACGATGCATCTAAATA
AGAAATCTACCCTTATTGA