Identifiers and Description

Gene Model Identifier

TTHERM_00554270

Standard Name

MCM2 (DNA replication licensing factor MCM2)

Aliases

PreTt29234 | 72.m00157

Description

Component of the Mcm2-7 complex involved in DNA replication

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00493 ) MCM2/3/5 family
  • ( PF00004 ) ATPase, AAA family
  • ( PF01078 ) Magnesium chelatase, subunit ChlI
  • ( PF07726 ) ATPase family associated with various
  • ( PF07728 ) ATPase family associated with various

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00554270

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_295070
WormBaseWBGene000031549.997093137033517e-262locus:mcm-2 status:Partially
_confirmed UniProt:Q9XXI9
protein_id:CAA19452.1
Tetrahymena borealisEI9_07326.19.997093137033517e-262MCM2/3/5 family protein (901 a
a)
DictyBaseDDB_G02866239.997093137033517e-262mcm2 on chromosome: 4 position
4745862 to 4748971
OxytrichaContig13625.0.g309.997093137033517e-262MCM2/3/5 family
SGDYBL023C9.997093137033517e-262MCM2 Protein involved in DNA r
eplication; component of the M
cm2-7 hexameric complex that b
inds chromatin as a part of th
e pre-replicative complex

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00554270(coding)
ATGGCTGGAAGAAGACGTAGAGATATGATTCCTGAAAATGTAGCTGACAACGATTCAGCT
AGCGTTTCTCAAGAAGAGGCTATAGAAGAAAATTAAATTGTAGAAGAAGATGACAAATCT
TTATCTGATGAAGGCGATGGTGATGATTTGCTTGAAAATATTGAAGATGATTACAAAGCT
GTTCCAGAATTGGATTAATACGAAATAGATGGTTTAAATGATGAAGATGACTTTGATGAT
ATTGATGCAGAACAAAGAAGATTAGCTGAAGAAGAAATTGATGAAAGAAACTATCAAAAA
TATGCCAACAAAAGAAGAATTCCAACTGCCTTAAGAGAGTTTGATTTAGGAGAAGAAGAC
GAAGAAGACTTAAATGTTCAACTTCAAAGAAGAAGATAATTTTATGAAGCTCATAATCTT
TATGAATCTGAAGATGATGAACAAATGGAAGAGGAAGAAGAAAATAAAGATGAAAGAGAA
TATGATAAGTATCTTGATAGAGAATAAGCTAGAGGTAAACTTGCAGTTTGGATTAAGGAA
GAGAGCACTGTGCGTTATATTCGTAAGACTTTCAGAAAGTTCCTCAATAAATTCAAAGAT
GGTTCAAATCAACTAGTTTACAAACAAAGAATTCAAGAAATGTGCTCTAAGAACAAAGGA
AGTTTGGAAGTCGACTTTAATCACATTAATTCTAAGCATGAAACTATAGCCATGTGGATT
GTTACAGAACCAGTAATTATTTTACCATATTTGAATGATGTTGCTATGGAAACAGTCAAG
AAACTTTATCCTGATTACGAAGATATTCAACCTGAAATATTTGTTAGAATTGAAAATTAC
ACAATCTTAGATCATATCAGAAAGCTTCGTCATAAAGATCTTGGTTAATTGATTTAAGTT
AGAGCAGTTGTTACTTAGCGCTCTGCTATTTTCTCTTAATTGAAGAAGGTTTATTATGTC
TGTCGCTGTGGTGATAGAAAAGGACCTATCTACTTATCATCAATAGAAAATCACAATCTT
GGTACTTGTCCTGTTTGCTAGTCTAAGGGACCTTTCATTTTGGATACTGAATATACTATC
TATAGAAATTACTAAAGACTCACTATTTAAGAACCACCTGGTAGCGTTCCTCCTGGTAGA
GTTCCTAGATAAAAAGAAGTCATCGTTTTAGGAGATAACATTGATGTTGCTCGTCCTGGT
GATGAAATTGATGTTACTGGTATTTTCGTTCATAGATATGACTATGCTTTAAATGTTAAG
CACGGTTTCCCTGTTTTTTCAACTATGATAGAAGCTAATTATATTAAGCGTGTAAGAGAA
GGTGATTAATCTTCCTTACCTCCTTAATTCATTGATGAAATTAATAAGCTCTCTAAGAGA
AGCAATTTATCTAAATTAATTTGCAATTCCATAGCTCCTTCTATTTATGAACATGATCAT
GTTAAAATGGCTCTTGCTCTTGCTATGTTCGGAGGTGAACACAAAGACATTTAAGGAAAA
CACAAAATCAGAGGTGATATCAACGTTCTCCTTCTTGGTGATCCTGGTGTTGCCAAATCT
CAATTCTTAAAGAGTGTAGAAAAAACTTTCCATAGATGCGTTTATACTACTGGTAAAGGT
GCATCTGCTGTCGGTTTAACTGCATCTGTAAAGAAAGATAGCTAAACAAAAGAATGGACT
CTTTAAGGTGGTGCTTTGGTTCTTGCTGATAAGGGTATTTGCTTAATTGATGAGTTTGAT
AAAATGAATGATCACGATAGAACTTCCATTCACGAAGCTATGGAACAATAAAGTATTTCT
ATTTCAAAGGTAGGTATTGTAGCAAATCTTCAAGCTAGATGTTCAGTTATTGCTGCTGCA
AACCCAGTCAAAGGTAGATATGATTCATCAGCATCTTTTATGGATAACGTTAATCTTACT
GATCCTATCTTATCCCGTTTTGATATCCTTTGCGTTATTAAAGATGAAGTAAACAAAGAT
CTTGATTATAAGCTTGCTGGTTTCGTACTCAACAGTCACATAAAGAATCACCCAATAAGC
CATAAAGAGAAAAAGCATAATCCTGAACTTTACAGCGAACGTCTTTCTAAATCTCTTATT
GAAGAATCTTAGAAGTAAATAGGTGAAATTATTCCTAATGAAACTTTAAGAAACTACATT
ATGTATGCTCGTTAAAAAATACATCCTAAGTTAGCTGACATTAAAAAAGAAAAAATTAAA
AAATTCTATTCTGACTTACGTTAATAATCAACTATTTCTGGAGGTATGACTATTGCAGTC
AGACATATTGAATCAATTATTAGAATGGCAGAAGCCCATGCTAAAATGCATCTCAGAGAA
GTCGTTAGAGATGAAGATATAGATGTTGCTATTAACGTTATGCTTGAAAGTTTTATTTAA
TCATAAAAGTACTCCGTAGCTAAAACAATACGCGATAACTTTAAAGTTTATTTAACAAAA
GCTTCTGATAATAATAAATATCTATTTAATTTACTAAATAAGCTTTAAAAGGAAAGTAAA
AAAGTTTTATAAAATGTTGCAGATGATAAGAAAGATAAAAAGCAAATTGAATAGACAAAT
ATACCAGTTTATCACTTTGAATTTTAGGCTAAAGACTATAAAATTGAAAAGTTCGACGAT
TTCTATAGAAGTGAATTATTCAATAGATACTACATTAAGCAAGGAAACTAAATTATACCT
AAAAACGATTTTTGA


>TTHERM_00554270(protein)
MAGRRRRDMIPENVADNDSASVSQEEAIEENQIVEEDDKSLSDEGDGDDLLENIEDDYKA
VPELDQYEIDGLNDEDDFDDIDAEQRRLAEEEIDERNYQKYANKRRIPTALREFDLGEED
EEDLNVQLQRRRQFYEAHNLYESEDDEQMEEEEENKDEREYDKYLDREQARGKLAVWIKE
ESTVRYIRKTFRKFLNKFKDGSNQLVYKQRIQEMCSKNKGSLEVDFNHINSKHETIAMWI
VTEPVIILPYLNDVAMETVKKLYPDYEDIQPEIFVRIENYTILDHIRKLRHKDLGQLIQV
RAVVTQRSAIFSQLKKVYYVCRCGDRKGPIYLSSIENHNLGTCPVCQSKGPFILDTEYTI
YRNYQRLTIQEPPGSVPPGRVPRQKEVIVLGDNIDVARPGDEIDVTGIFVHRYDYALNVK
HGFPVFSTMIEANYIKRVREGDQSSLPPQFIDEINKLSKRSNLSKLICNSIAPSIYEHDH
VKMALALAMFGGEHKDIQGKHKIRGDINVLLLGDPGVAKSQFLKSVEKTFHRCVYTTGKG
ASAVGLTASVKKDSQTKEWTLQGGALVLADKGICLIDEFDKMNDHDRTSIHEAMEQQSIS
ISKVGIVANLQARCSVIAAANPVKGRYDSSASFMDNVNLTDPILSRFDILCVIKDEVNKD
LDYKLAGFVLNSHIKNHPISHKEKKHNPELYSERLSKSLIEESQKQIGEIIPNETLRNYI
MYARQKIHPKLADIKKEKIKKFYSDLRQQSTISGGMTIAVRHIESIIRMAEAHAKMHLRE
VVRDEDIDVAINVMLESFIQSQKYSVAKTIRDNFKVYLTKASDNNKYLFNLLNKLQKESK
KVLQNVADDKKDKKQIEQTNIPVYHFEFQAKDYKIEKFDDFYRSELFNRYYIKQGNQIIP
KNDF


>TTHERM_00554270(gene)
ATGGCTGGAAGAAGACGTAGAGATATGATTCCTGAAAATGTAGCTGACAACGAGTAATTC
TTTTGCCTTTTTTTAAAGACTTTCATTAAATGATTAATTATTAATTTTTTAAATTTAGTT
CAGCTAGCGTTTCTCAAGAAGAGGCTATAGAAGAAAATTAAATTGTAGAAGAAGATGACA
AATCTTTATCTGATGAAGGCGATGGTGATGATTTGCTTGAAAATATTGAAGATGATTACA
AAGCTGTTCCAGAATTGGATTAATACGAAATAGATGGTTTAAATGATGAAGATGACTTTG
ATGATATTGATGCAGAACAAAGAAGATTAGCTGAAGAAGAAATTGATGAAAGAAACTATC
AAAAGTAAGCACAAAAAATAACTATAAAACAGGATAAAAATTATTATTTGAAAACGTAGA
TATGCCAACAAAAGAAGAATTCCAACTGCCTTAAGAGAGTTTGATTTAGGAGAAGAAGAC
GAAGAAGACTTAAATGTTCAACTTCAAAGAAGAAGATAATTTTATGAAGCTCATAATCTT
TATGAATCTGAAGATGATGAACAAATGGAAGAGGAAGAAGAAAATAAAGATGAAAGAGAA
TATGATAAGTATCTTGATAGAGAATAAGCTAGAGGTAAACTTGCAGTTTGGATTAAGGAA
GAGAGCACTGTGCGTTATATTCGTAAGACTTTCAGAAAGTTCCTCAATAAATTCAAAGAT
GGTTCAAGTAAATAAATATTTAATTTATTTTGATTTACTCCAAGAAGCACTATCAAAATT
AAAGCATAAGATTTAGTGAGCAAAGATTAAAAAATGTTTAAAAATAAAAAATCTTTCATA
AAATATAAAAAATAATATTATTTTTCTGCAAATTTAGTTAGATATAATAAATAATATTAA
GGTGTTTGTAATGGAAAAAAATAAAGTTTAGAGAAAATTTTGAATAATCAAAAAATTTGA
TATTAGCAAATAGATATTATTATTTTGATAAATAAATAAATAAAAAGTTAATTTAATTAG
CACATAATTGAATAAATATTAAATATAAATAGATCAACTAGTTTACAAACAAAGAATTCA
AGAAATGTGCTCTAAGAACAAAGGAAGTTTGGAAGTCGACTTTAATCACATTAATTCTAA
GCATGAAACTATAGCCATGTGGATTGTTACAGAACCAGTAATTATTTTACCATATTTGAA
TGATGTTGCTATGGAAACAGTCAAGAAACTTTATCCTGATTACGAAGATATTCAACCTGA
AATATTTGTTAGAATTGAAAATTACACAATCTTAGATCATATCAGAAAGCTTCGTCATAA
AGATCTTGGTTAATTGATTTAAGTTAGAGCAGTTGTTACTTAGCGCTCTGCTATTTTCTC
TTAATTGAAGAAGGTTTATTATGTCTGTCGCTGTGGTGATAGAAAAGGACCTATCTACTT
ATCATCAATAGAAAATCACAATCTTGGTACTTGTCCTGTTTGCTAGTCTAAGGGACCTTT
CATTTTGGATACTGAATATACTATCTATAGAAATTACTAAAGACTCACTATTTAAGAACC
ACCTGGTAGCGTTCCTCCTGGTAGAGTTCCTAGATAAAAAGAAGTCATCGTTTTAGGAGA
TAACATTGATGTTGCTCGTCCTGGTGATGAAATTGATGTTACTGGTATTTTCGTTCATAG
ATATGACTATGCTTTAAATGTTAAGCACGGTTTCCCTGTTTTTTCAACTATGATAGAAGC
TAATTATATTAAGCGTGTAAGAGAAGGTGATTAATCTTCCTTACCTCCTTAATTCATTGA
TGAAATTAATAAGCTCTCTAAGAGAAGCAATTTATCTAAATTAATTTGCAATTCCATAGC
TCCTTCTATTTATGAACATGATCATGTTAAAATGGCTCTTGCTCTTGCTATGTTCGGAGG
TGAACACAAAGACATTTAAGGAAAACACAAAATCAGAGGTGATATCAACGTTCTCCTTCT
TGGTGATCCTGGGTAATTTTTAGTTTTGTTTCAAATATTTTATCAAAAATATGAATTTAT
TTTCTTATCAATTATTTTTGTAATAATAGTGTTGCCAAATCTCAATTCTTAAAGAGTGTA
GAAAAAACTTTCCATAGATGCGTTTATACTACTGGTAAAGGTGCATCTGCTGTCGGTTTA
ACTGCATCTGTAAAGAAAGATAGCTAAACAAAAGAATGGACTCTTTAAGGTGGTGCTTTG
GTTCTTGCTGATAAGGGTATTTGCTTAATTGATGAGTTTGATAAAATGAATGATCACGAT
AGAACTTCCATTCACGAAGCTATGGAACAATAAAGTATTTCTATTTCAAAGGTAGGTATT
GTAGCAAATCTTCAAGCTAGATGTTCAGTTATTGCTGCTGCAAACCCAGTCAAAGGTAGA
TATGATTCATCAGCATCTTTTATGGATAACGTTAATCTTACTGATCCTATCTTATCCCGT
TTTGATATCCTTTGCGTTATTAAAGATGAAGTAAACAAAGATCTTGATTATAAGCTTGCT
GGTTTCGTACTCAACAGTCACATAAAGAATCACCCAATAAGCCATAAAGAGAAAAAGCAT
AATCCTGAACTTTACAGCGAACGTCTTTCTAAATCTCTTATTGAAGAATCTTAGAAGTAA
ATAGGTGAAATTATTCCTAATGAAACTTTAAGAAACTACATTATGTATGCTCGTTAAAAA
ATACATCCTAAGTTAGCTGACATTAAAAAAGAAAAAATTAAAAAATTCTATTCTGACTTA
CGTTAATAATCAACTATTTCTGGAGGTATGACTATTGCAGTCAGACATATTGAATCAATT
ATTAGAATGGCAGAAGGTAATATTTTTATTTTCAATTTTATTATTTTAGCTAAAAAAATT
TTTATTAAAAGCCCATGCTAAAATGCATCTCAGAGAAGTCGTTAGAGATGAAGATATAGA
TGTTGCTATTAACGTTATGCTTGAAAGTTTTATTTAATCATAAAAGTACTCCGTAGCTAA
AACAATACGCGATAACTTTAAAGTTTATTTAACAAAAGCTTCTGATAATAATAAATATCT
ATTTAATTTACTAAATAAGCTTTAAAAGGAAAGTGTAAATAATTATTAAATTAATAAAAT
TATTTTTCAAATCTTATTTTATCTCTTTAATAGAAAAAAGTTTTATAAAATGTTGCAGAT
GATAAGAAAGATAAAAAGCAAATTGAATAGACAAATATACCAGTTTATCACTTTGAATTT
TAGGCTAAAGACTATAAAATTGAAAAGTTCGAGTAAGATTTTTTATTTTACAGATTATTC
AAACGTTTGCCTAATATTTTTATTTTTTAAAAAATAGCGATTTCTATAGAAGTGAATTAT
TCAATAGATACTACATTAAGCAAGGAAACTAAATTATACCTAAAAACGATTTTTGA