Identifiers and Description

Gene Model Identifier

TTHERM_00691850

Standard Name

MCF9 (Mitochondrial Carrier Family 9)

Aliases

PreTt03023 | 106.m00163 | 3674.m00076

Description

Mitochondrial carrier protein; putative dicarboxylate/phosphate carrier

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00153 ) Mitochondrial carrier protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 17.9%

TetraMine Data

TTHERM_00691850

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17556.12.9998475177091926e-177mitochondrial carrier protein
(302 aa)
DictyBaseDDB_G02801610.0000000000000299873730555305mcfK on chromosome: 3 position
3035184 to 3036248
WormBaseWBGene000076220.00000000000004998767099442072Uncharacterized mitochondrial
carrier C16C10.1 status:Conf
irmed UniProt:Q09461 prote
in_id:CAA86739.2
SGDYNL003C0.00000000000059990805086298PET8 S-adenosylmethionine tran
sporter of the mitochondrial i
nner membrane, member of the m
itochondrial carrier family; r
equired for biotin biosynthesi
s and respiratory growth
OxytrichaContig14613.0.g860.000000000003998907168546896Mitochondrial carrier protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00691850(coding)
ATGAGTACTCAAACATAACAATAAAAAAAGCAAAGAAACATTCTTCACATTTGTTTAAGC
TCAATGACATCTGCTGCAATAACTAATTCAATATTAGTACCTTTAGATGTAATTAAAATT
AGATTGTAAAAGTCATCTATGGAGTAGAAGGTGGGAAAAGTGTCTTTTTTATCAACTCTT
AAACATATAGTTAAGCAAGAAGGAGTTAAGACACTGTTTAATGGCCTCTAGTATTCAGTT
TATTAAAGTGTTGGATTTAATTTAACAATGTTATTAGTTTATGAAAGATTATCTCATTTT
GTAGAACATAATATAACAAGCAATTCTTATTATAAACCTCTTATCACTTCTGTCTTCTCT
ACATCAATTGGCACTACTTTAGCATTCCCACTCGAATATTGGAAAACTGTATAATAATCA
AATGAAGGAGTTTCCAATAAAAAGGGCTTTTAACTAGGTAATAGAATATACTCTGCCTTA
ATAGTTTCCATATAAAGAAATGTTGGATTTTTCATTTTCTTTTGGCCTATAAGCGAAAAT
GTAAAGAAGTTCTTGATTTAAAAGCATTATTTTTCTGAATTAAAAACCTACTAAAAAGGT
AGTGGAAGTGACAAATAAACTTAATATTTGATTAAAAACTTTATTTTGAATTGGTCTGCT
GGTATTTGCGGGGCCAGTGTTGCTGGTTTCTTGACTTAACCATTCGATGTACTTAAAACT
CGTAAATAAATAAATGAAGTGTATGGAAAATAGGGAAGTATCTAATTAATGACTGATATT
GTAAAAAATGAAGGAGTAAGTCACTTATTTGTAGGCCTTTAACCAAGATTTGTTAAGGTT
TTAGTATATGGAAGTATGTTCTTCTCTATCTATGAAAATTTTTTGCATTTATGTGATTCT
CACCTTCCATTCTGA


>TTHERM_00691850(protein)
MSTQTQQQKKQRNILHICLSSMTSAAITNSILVPLDVIKIRLQKSSMEQKVGKVSFLSTL
KHIVKQEGVKTLFNGLQYSVYQSVGFNLTMLLVYERLSHFVEHNITSNSYYKPLITSVFS
TSIGTTLAFPLEYWKTVQQSNEGVSNKKGFQLGNRIYSALIVSIQRNVGFFIFFWPISEN
VKKFLIQKHYFSELKTYQKGSGSDKQTQYLIKNFILNWSAGICGASVAGFLTQPFDVLKT
RKQINEVYGKQGSIQLMTDIVKNEGVSHLFVGLQPRFVKVLVYGSMFFSIYENFLHLCDS
HLPF


>TTHERM_00691850(gene)
ATGAGTACTCAAACATAACAATAAAAAAAGCAAAGAAACATTCTTCACATTTGTTTAAGC
TCAATGACATCTGCTGCAATAACTAATTCAATATTAGTACCTTTAGATGTAATTAAAATT
AGATTGTAAAAGTCATCTATGGAGTAGAAGGTGGGAAAAGTGTCTTTTTTATCAACTCTT
AAACATATAGTTAAGCAAGAAGGAGTTAAGACACTGTTTAATGGCCTCTAGTATTCAGTT
TATTAAAGTGTTGGATTTAATTTAACAATGTTATTAGTTTATGAAAGATTATCTCATTTT
GTAGAACATAATATAACAAGCAATTCTTATTATAAACCTCTTATCACTTCTGTCTTCTCT
ACATCAATTGGCACTACTTTAGCATTCCCACTCGAATATTGGAAAACTGTATAATAATCA
AATGAAGGAGTTTCCAATAAAAAGGGCTTTTAACTAGGTAATAGAATATACTCTGCCTTA
ATAGTTTCCATATAAAGAAATGTTGGATTTTTCATTTTCTTTTGGCCTATAAGCGAAAAT
GTAAAGAAGTTCTTGATTTAAAAGCATTATTTTTCTGAATTAAAAACCTACTAAAAAGGT
AGTGGAAGTGACAAATAAACTTAATATTTGATTAAAAACTTTATTTTGAATTGGTCTGCT
GGTATTTGCGGGGCCAGTGTTGCTGGTTTCTTGACTTAACCATTCGATGTACTTAAAACT
CGTAAATAAATAAATGAAGTGTATGGAAAATAGGGAAGTATCTAATTAATGACTGATATT
GTAAAAAATGAAGGAGTAAGTCACTTATTTGTAGGCCTTTAACCAAGATTTGTTAAGGTT
TTAGTATATGGAAGTATGTTCTTCTCTATCTATGAAAATTTTTTGCATTTATGTGATTCT
CACCTTCCATTCTGA