Identifiers and Description

Gene Model Identifier

TTHERM_02139630

Standard Name

MCF8 (Mitochondrial Carrier Family 8)

Aliases

PreTt01834 | 1121.m00002

Description

Mitochondrial carrier protein; facilitates transport across mitochondrial membranes

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00153 ) Mitochondrial carrier protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_02139630

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20254.18.998549051015915e-36mitochondrial carrier protein
(310 aa)
SGDYMR056C3.99801309251602e-27AAC1 Mitochondrial inner membr
ane ADP/ATP translocator, exch
anges cytosolic ADP for mitoch
ondrially synthesized ATP; pho
sphorylated; Aac1p is a minor
isoform while Pet9p is the maj
or ADP/ATP translocator
WormBaseWBGene000201402.0002795641672355e-21locus:ant-1.4 status:Confirm
ed UniProt:G5EFU2 protein_
id:CCD65922.1
OxytrichaContig10229.0.g329.997019043202629e-21Mitochondrial carrier protein
DictyBaseDDB_G02674545.000468829272308e-18ancA on chromosome: 1 position
424007 to 425518

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000201

Sequences

>TTHERM_02139630(coding)
ATGTCTCTTTGGTATCCTCTAGAAGTAGCTAGGATTAAACTTACAAATGATAAATTTATT
ATAAATACTTAAAAAAAATAATACCTAAGTATAACTGATGTTTGCAAATAAACTCTCATA
AAGGAAGGGCCTAATGGGCTTTACAGAGGTTATGGAATCTCCTGTTTTGGTATGTTTTTT
TATAGAGGCCTCTTTTTTGCTTTGTCTGAAATAACAAATAAATACACTTTAGATGATAAT
GCAATAAATTTTATTCAAATGCAGTTTTTGTTAGGATGGAGTATACAATTTTTATCTTAG
CTATTAACATATCCTTTTTACACCATAAGTAGCAGAATGATAATGTCCTCTGGGTCTACC
TAAAGATATACTTAGTCTCTTCAGTGCATATAAACAATTAAAAAATAAGAAGGACTTAAA
TCACTATATAGAGGAGTTAGCATTAACATTTTTAAAAGTTTAGGAGGAGCATCTTCATTC
GTTTTATATACCTATGGATTTAAAGAGTATTCTCTTGATTCAAAAAATTTTTGA


>TTHERM_02139630(protein)
MSLWYPLEVARIKLTNDKFIINTQKKQYLSITDVCKQTLIKEGPNGLYRGYGISCFGMFF
YRGLFFALSEITNKYTLDDNAINFIQMQFLLGWSIQFLSQLLTYPFYTISSRMIMSSGST
QRYTQSLQCIQTIKKQEGLKSLYRGVSINIFKSLGGASSFVLYTYGFKEYSLDSKNF


>TTHERM_02139630(gene)
ATGTCTCTTTGGTATCCTCTAGAAGTAGCTAGGATTAAACTTACAAATGATAAATTTATT
ATAAATACTTAAAAAAAATAATACCTAAGTATAACTGATGTTTGCAAATAAACTCTCATA
AAGGAAGGGCCTAATGGGCTTTACAGAGGTTATGGAATCTCCTGTTTTGGTATGTTTTTT
TATAGAGGCCTCTTTTTTGCTTTGTCTGAAATAACAAATAAATACACTTTAGATGATAAT
GCAATAAATTTTATTCAAATGCAGTTTTTGTTAGGATGGAGTATACAATTTTTATCTTAG
CTATTAACATATCCTTTTTACACCATAAGTAGCAGAATGATAATGTCCTCTGGGTCTACC
TAAAGATATACTTAGTCTCTTCAGTGCATATAAACAATTAAAAAATAAGAAGGACTTAAA
TCACTATATAGAGGAGTTAGCATTAACATTTTTAAAAGTTTAGGAGGAGCATCTTCATTC
GTTTTATATAGTTTATATCTTCAAAAATAAAATTATAAAATTTAATAAAATTTTAATAAA
TGAATTGATTAATTGTATTAAATTAAATGTTTCTATTTTTATAATACTTTTATAACAATA
CAAATTCAACAATTTGAAACTTCACTCTTTTTTTAATAATGAATCTATCTAATTTTAATA
TTTTCAATTTTTTTAAAAAATAAGGGTACAATAAAATTTTTATTTTTAGCCTATGGATTT
AAAGAGTATTCTCTTGATTCAAAAAATTTTTGA