Identifiers and Description

Gene Model Identifier

TTHERM_00474670

Standard Name

MCF7 (Mitochondrial carrier family)

Aliases

PreTt02267 | 57.m00206 | 3709.m00066

Description

Mitochondrial carrier protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00153 ) Mitochondrial carrier protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00474670

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13143.11.999489510516749e-128mitochondrial carrier protein
(337 aa)
OxytrichaContig20765.0.g621.9997255150861791e-53Mitochondrial carrier protein
DictyBaseDDB_G02920348.998739065740874e-48mcfP on chromosome: 6 position
1058459 to 1059755
SGDYPR011C8.003782782428492e-46YPR011C Putative transporter,
member of the mitochondrial ca
rrier family; the authentic, n
on-tagged protein is detected
in highly purified mitochondri
a in high-throughput studies
WormBaseWBGene000081479.99723014177113e-33status:Confirmed UniProt:Q18
683 protein_id:CAA93110.1
Stentor CoeruleusSteCoe_323824.780892883885469e-25

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00474670(coding)
ATGAAAAAAATTTTATTAATGCCACCTTTTTAACTTTTTTTTAAATTAAAAATGCTCAAT
AAAATTTATTATTTTGCTAATATTTTTAGAGTAGTTCAAATAATAAATATTTGCGCGAAA
TATTCATATGATATTTTATAAATATTAGATTGTTGGTTGCTAGAAATTACTTTAAATAGA
AGTAAAAAATATTAATTAATTTTAAAAAAAAACTTTGATTTATTATTTATCTAATCAATG
AACGATCTTTACAACTTTTTAGCTGGAGGTATCTCAGGAGTAGCTTCAAGAACAGCTGTA
GCTCCTATTGAAAGAGTGATCATCCTTAAGCAAACTTCTATTGAGTAGTATTAAGGAAGT
AATACAATTTAAGCTATTCTAAAAATGTATAAAATTGAAGGTGTAAGATCTCTCTTCAAA
GGCAATTATGTCAATTGTTTAAGAATATTCCCTTTTTAAGCTATTGAATTCTTCATGTTT
GATAAATACAAAAAATCATACAATCAATATATGTCAAGCTATATACAGCTAAACAGAGTA
GCTCTTGATCTAATAGCTGGAGCATTAGCTGGAGTTACAGCTTCTGCCTGCATTTATCCT
TTAGACTTAGCTAAGACTCATCTAGCTGTTAACATCTCAAAAACACCAAACGCATCTAAC
CCAGGATGTATATAAATTTGGAAAGAAATTATTCTTCATGAAGGTTTCAGAGGACTTTTT
AAAGGACTCTCTGCTACAATGATTGGCATGGCTCCTTATGCTAGCTTAAAGCTAACTTTC
TTCAATAACTTATAGTATTACGCAAGTAAATAGTTAAATAAAGATTAAAAATAAATGCCC
CTTTATTGGAACCTTGCTATTGGCGGTCTTTCAGGATGTCTAGCTGTTACTATAACCTAT
CCCACTGACCTGATTCGTAGAAATTTGCAAATAGCAAAAATGAATTCTAATACTAAACCA
ACTTATCTTAGTATAATAAAAAAAATTTACAACAAAAGTGGTTTAATTGGCCTATACAGA
GGGTTACCTGCAACTTACTGCAAAATTTTACCTTCTACAGCTATAGTTTTTGCAATCAAT
GACTGTTTGAAATAAATTAGAACAAAATTCCAAACAGGTAAACTCTTACAATATTGA


>TTHERM_00474670(protein)
MKKILLMPPFQLFFKLKMLNKIYYFANIFRVVQIINICAKYSYDILQILDCWLLEITLNR
SKKYQLILKKNFDLLFIQSMNDLYNFLAGGISGVASRTAVAPIERVIILKQTSIEQYQGS
NTIQAILKMYKIEGVRSLFKGNYVNCLRIFPFQAIEFFMFDKYKKSYNQYMSSYIQLNRV
ALDLIAGALAGVTASACIYPLDLAKTHLAVNISKTPNASNPGCIQIWKEIILHEGFRGLF
KGLSATMIGMAPYASLKLTFFNNLQYYASKQLNKDQKQMPLYWNLAIGGLSGCLAVTITY
PTDLIRRNLQIAKMNSNTKPTYLSIIKKIYNKSGLIGLYRGLPATYCKILPSTAIVFAIN
DCLKQIRTKFQTGKLLQY


>TTHERM_00474670(gene)
AAAATAAATTTATATTTAATTTTACTTAAAAAACTTTAAATATAGTACAGAAATTCTATT
TACAATATTTATTTCTTTGTAACAATTTAATTTTTATTATATGAAAAAAATTTTATTAAT
GCCACCTTTTTAACTTTTTTTTAAATTAAAAATGCTCAATAAAATTTATTATTTTGCTAA
TATTTTTAGAGTAGTTCAAATAATAAATATTTGCGCGAAATATTCATATGATATTTTATA
AATATTAGATTGTTGGTTGCTAGAAATTACTTTAAATAGAAGTAAAAAATATTAATTAAT
TTTAAAAAAAAACTTTGATTTATTATTTATCTAATCAATGAACGATCTTTACAACTTTTT
AGCTGGAGGTATCTCAGGAGTAGCTTCAAGAACAGCTGTAGCTCCTATTGAAAGAGTGAT
CATCCTTAAGCAAACTTCTATTGAGTAGTATTAAGGAAGTAATACAATTTAAGCTATTCT
AAAAATGTATAAAATTGAAGGTGTAAGATCTCTCTTCAAAGGCAATTATGTCAATTGTTT
AAGAATATTCCCTTTTTAAGCTATTGAATTCTTCATGTTTGATAAATACAAAAAATCATA
CAATCAATATATGTCAAGCTATATACAGCTAAACAGAGTAGCTCTTGATCTAATAGCTGG
AGCATTAGCTGGAGTTACAGCTTCTGCCTGCATTTATCCTTTAGACTTAGCTAAGACTCA
TCTAGCTGTTAACATCTCAAAAACACCAAACGCATCTAACCCAGGATGTATATAAATTTG
GAAAGAAATTATTCTTCATGAAGGTTTCAGAGGACTTTTTAAAGGACTCTCTGCTACAAT
GATTGGCATGGCTCCTTATGCTAGCTTAAAGCTAACTTTCTTCAATAACTTATAGTATTA
CGCAAGTAAATAGTTAAATAAAGATTAAAAATAAATGCCCCTTTATTGGAACCTTGCTAT
TGGCGGTCTTTCAGGATGTCTAGCTGTTACTATAACCTATCCCACTGACCTGATTCGTAG
AAATTTGCAAATAGCAAAAATGAATTCTAATACTAAACCAACTTATCTTAGTATAATAAA
AAAAATTTACAACAAAAGTGGTTTAATTGGCCTATACAGAGGGTTACCTGCAACTTACTG
CAAAATTTTACCTTCTACAGCTATAGTTTTTGCAATCAATGACTGTTTGAAATAAATTAG
AACAAAATTCCAAACAGGTAAACTCTTACAATATTGAGGAAAAGAAAAATGAAAACTAGA
CAAAACTAATGAAAAAGCTAAATATTATTTATATAACCAACTATATTAGAAAAAATTAAA
GAAAAAAATATAATTATTCTTCTTATTTTGATCATTTAAACAATAATAATAAATATATAT
AAACACTCATATGAAAAATATTAAATTTTGATGAATTAATATCAATATTTTGTAATTATT
TATATCTCTACTATTAATTACTACTTGTATCTATAATTTTGATTTTGAAATTTTCATTTG
ATAAGAAAATCTTTTTCATTAGATTTATTATTTCAACTTTTTAACGAAAATTTATTATTA
TTCAGCAACATTTGAAAATAAATAAGACACAC