Identifiers and Description

Gene Model Identifier

TTHERM_00627190

Standard Name

MCF6 (Mitochondrial carrier family)

Aliases

PreTt24644 | 88.m00112 | 3822.m00635

Description

Mitochondrial carrier protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 20.3%

TetraMine Data

TTHERM_00627190

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17298.19.997093137033517e-262mitochondrial carrier protein
(304 aa)
SGDYPR058W9.995951036711152e-55YMC1 Mitochondrial protein, pu
tative inner membrane transpor
ter with a role in oleate meta
bolism and glutamate biosynthe
sis; member of the mitochondri
al carrier (MCF) family; has s
imilarity with Ymc2p
DictyBaseDDB_G02909132.000704504372864e-47mcfS on chromosome: 5 position
4740703 to 4741678
WormBaseWBGene000083206.999359373303508e-39status:Partially_confirmed U
niProt:Q18844 protein_id:CAA
99811.1
Stentor CoeruleusSteCoe_354638.75651076269652e-27
OxytrichaContig20765.0.g621.0000422327488734e-24Mitochondrial carrier protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00627190(coding)
ATGTAAAAATAAATAAATATTAACTTTTCTTTGCAGTTGGTTGGTATATCCAAACAATTT
TTGATTACATTTTAAAATGAAAACAGAATTAGATTCTTTAAAAGCTCAAAAATCTCCACT
TAGTTATAATTAAAAACAATCATAAACATAACAAATATCTGCTAATAAAAAAAAGGAATT
AAAAGCAAAAGCGCTTCACTTTAAATAGGTAAACTACTTCTCACAAAACACTACTCTTAC
TCAAAATCATTTAAATTCATGAGCTACTCTGCTAAAACTTAAAAATCCTACATTTCCCAA
GACTCTTTGGTTTTCAAATACAGAGATTACATCGCTGGATGTTTGGGAGGTATCGCATAA
GCCTTAATTGGTTAGCCCTTTGATACAATTAAAGTTAGATTACAATCTTCCACAGGCTAG
ATTTCAACTGGCTAATGCATCAAAAATCTTATCAAGAATGAAGGACCCCTTGCTTTTTAC
AAAGGTATTGGATCACCTTTAATTTGCATGAGTGGTGTAGTTTCTATTTAATTCGGTGTT
TTCCAAAGAGTTGTTAACGCTTTCAAAGAAGCTTAAAAAACTAAATTCCTTTCTACATTC
TAAATGGGTGTTTGTGGATCAATTGCTGGTTTATTCGCTTGTTCTGTTCTTTCTCCTATG
GAACACATCAGAATCAGACTTTAAGTTATGCAAAACTCTATCTACAATGGAGCTATAGAT
TGTGCTAAGAAGATATACCTTGAACATGGTTTAAGAGGAATCTATAAGGGTTTAACAATT
ACCTGTTTAAGAGAAGTTCCTGCCTTATTTGCTTACTTTGGATCTTACCACGGTGTCTTG
AGAGCTATCTAAGGAGCTTACAATAATAATCAATAAGAATTAGCTGTCAAGTGTGCCCCT
CTTGTCGCTGGTGCTGTTGCTGGTATTGCATACTGCACCTTTACCTATCCTATCGATACT
ATTAAATCAAGAATCTAAACTGACAACTTTGTCAATCCTAAATACAACGGCATTGTTGAT
GGCTTTAAAAAGACTATCAAGGCTCAAGGATTTGGTTCTTTATATAAAGGTTATGGTATC
ACTTTTGTTAGAGGTATTCCCGTCAATGCAGCAAGTTTCTTAATTTTTGAAAATGTTAAG
GCCTTGATCGAAGAAAATGCCATGTATTGA


>TTHERM_00627190(protein)
MQKQININFSLQLVGISKQFLITFQNENRIRFFKSSKISTQLQLKTIINITNICQQKKGI
KSKSASLQIGKLLLTKHYSYSKSFKFMSYSAKTQKSYISQDSLVFKYRDYIAGCLGGIAQ
ALIGQPFDTIKVRLQSSTGQISTGQCIKNLIKNEGPLAFYKGIGSPLICMSGVVSIQFGV
FQRVVNAFKEAQKTKFLSTFQMGVCGSIAGLFACSVLSPMEHIRIRLQVMQNSIYNGAID
CAKKIYLEHGLRGIYKGLTITCLREVPALFAYFGSYHGVLRAIQGAYNNNQQELAVKCAP
LVAGAVAGIAYCTFTYPIDTIKSRIQTDNFVNPKYNGIVDGFKKTIKAQGFGSLYKGYGI
TFVRGIPVNAASFLIFENVKALIEENAMY


>TTHERM_00627190(gene)
ATGTAAAAATAAATAAATATTAACTTTTCTTTGCAGTTGGTTGGTATATCCAAACAATTT
TTGATTACATTTTAAAATGAAAACAGAATTAGATTCTTTAAAAGCTCAAAAATCTCCACT
TAGTTATAATTAAAAACAATCATAAACATAACAAATATCTGCTAATAAAAAAAAGGAATT
AAAAGCAAAAGCGCTTCACTTTAAATAGGTAAACTACTTCTCACAAAACACTACTCTTAC
TCAAAATCATTTAAATTCATGAGCTACTCTGCTAAAACTTAAAAATCCTACATTTCCCAA
GACTCTTTGGTTTTCAAATACAGAGATTACATCGCTGGATGTTTGGGAGGTAATTTTTCA
TTTTTATTAATATTTATCATAAAAAATTCACTCAAAAAGACACAGTCTAAGTCTATCTAT
CTAATATAAAATAGGTATCGCATAAGCCTTAATTGGTTAGCCCTTTGATACAATTAAAGT
TAGATTACAATCTTCCACAGGCTAGATTTCAACTGGCTAATGCATCAAAAATCTTATCAA
GAATGAAGGACCCCTTGCTTTTTACAAAGGTAATTAATTATTTTTTATATTAAATTCAAC
ATTGACAAGATTCAAATAAATTAGCTAGTAATAAATAAATAAATTAATTAATTAGCAAGA
TAGATAGATTGATTGAAATAGAGATAAATTGATATTAAGGATTCGAAATTTTAACCTATT
TCAAAAATACCAAAAAATATAAAAAAACGGATTAATTAAAGCTGAATCATTTATTTTAAT
AGATTAATTGATTGATTGATTTGAAAATAAAATTTTTTTGATAAGGATTAATAACTAGTT
AAAATATTAGCCTGAATTTAAAAAAGTCTATCTATCTTTCTATTTCATTTTGTTGTGAAT
CTTTAATCGGTGTTGTTTTAAAAGCAAAAATAAATTGACGATCAAATTGTTTTTATGAAT
CATATTTACTTTATCATTATCAAATAGGTATTGGATCACCTTTAATTTGCATGAGTGGTG
TAGTTTCTATTTAATTCGGTGTTTTCCAAAGAGTTGTTAACGCTTTCAAAGAAGCTTAAA
AAACTAAATTCCTTTCTACATTCTAAATGGGTGTTTGTGGATCAATTGCTGGTTTATTCG
CTTGTTCTGTTCTTTCTCCTATGGAACACATCAGAATCAGACTTTAAGTTATGCAAAACT
CTATCTACAATGGAGCTATAGATTGTGCTAAGAAGATATACCTTGAACATGGTTTAAGAG
GAATCTATAAGGGTTTAACAATTACCTGTTTAAGAGAAGTTCCTGCCTTATTTGCTTACT
TTGGATCTTACCACGGTGTCTTGAGAGCTATCTAAGGAGCTTACAATAATAATCAATAAG
AATTAGCTGTCAAGTGTGCCCCTCTTGTCGCTGGTGCTGTTGCTGGTATTGCATACTGCA
CCTTTACCTATCCTATCGATACTATTAAATCAAGAATCTAAACTGACAACTTTGTCAATC
CTAAATACAACGGCATTGTTGATGGCTTTAAAAAGACTATCAAGGCTCAAGGATTTGGTT
CTTTATATAAAGGTTATGGTATCACTTTTGTTAGAGGTATTCCCGTCAATGCAGCAAGTT
TCTTAATTTTTGAAAATGTTAAGGCCTTGATCGAAGAAAATGCCATGTATTGA