Identifiers and Description

Gene Model Identifier

TTHERM_00420020

Standard Name

MCF5 (Mitochondrial carrier family)

Aliases

PreTt07127 | 46.m00182 | 3679.m00032

Description

Mitochondrial carrier protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00153 ) Mitochondrial carrier protein
  • ( TIGR00119 ) acetolactate synthase, small subunit

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00420020

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11065.19.997093137033517e-262mitochondrial carrier protein
(320 aa)
DictyBaseDDB_G02909131.999534248571833e-46mcfS on chromosome: 5 position
4740703 to 4741678
SGDYPR058W2.99915080840225e-45YMC1 Mitochondrial protein, pu
tative inner membrane transpor
ter with a role in oleate meta
bolism and glutamate biosynthe
sis; member of the mitochondri
al carrier (MCF) family; has s
imilarity with Ymc2p
WormBaseWBGene000083201.0003081162615753e-33status:Partially_confirmed U
niProt:Q18844 protein_id:CAA
99811.1
OxytrichaContig13637.0.1.g281.0002124404074584e-26Mitochondrial carrier protein
Stentor CoeruleusSteCoe_354635.74952226429356e-19

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00420020(coding)
ATGTAATAATATTTCTAAGTATATTATTTAGTAATTAGTACTTTCTTTTAGAAAATTAGC
AGAAATTTCCTAATTAATCTCTTTTTTCAGCCAAGCAATATGACAAACTAAGCAAGCAGC
AATCAACTAGCCCCGGCTTTAGGATACCAAAAAATACCAGTCTAATAGTAACATATCAAG
AAACTGACAGTAGATTTATTAGCAGGAATGATTACAGGATGGGTTTCTGTAATAACCTTG
CAACCTCTAGATATGATCAAAACAACCATGCAAACAAGCTCCAACAAACAAAGCATATTA
GGTTGTGCAAAAGAAATATACTAAAAGTCAAAAATGAAAGGTTTTTATAAGGGTATGCTC
TTTCCTTTGATAGGCTCTAGCTTTTTTTCTGCCATTTACTACGGTTCTAATGAATAGATG
AAAAAATTAATATGCTTTTTATCGAATCACAAGTATGATAGAACTAGCTTGCCATTATAA
TATGTTTTCTTTTCAGGATCTTTTGCTGGTTTAACTACTTCATGTGTTTCTATTCCTATA
GAGCATGTAAAAATAAGACTATAAACATAAAAAAACCAATAATATACTGGCTCAATTGAT
TGCTTTAAAAAGATATTAAGAAATCATGGTGTAGTAGGACTTTACAAATCATCTATCCTT
TAATTATCAAGAGATTTTATAGGCTGTGGAAGCTTTTTTGTAATGTATGATATAACAAAG
AGATACTTCAAAAAGTAAAATAATGGAGAATTAGATAAATTAAGATTGTTTTTAAGTGGG
TGTGTAGCTGGAATGTCATATTGGCCTCTCTGCTTCCCACTAGATGTAATTAAAACAAAA
ATGCAGAGTGATTCATTCGTTAAACCCTAATTTTAAAATATAAAAGACTGTGCTCTTCAA
ATTTATAGATATGAAAATAGGGGATTTTTAAATTTTTATAAAGGATTTTTAATAAGTAAT
ATAAGATCTATTCCTAACTCAGCTATTGCACTTTTTACCTTTGAAAATGTTTTAGGATTT
CTTTCTAAATTATTTGGAATTCAAAAACCCAAGCATTGA


>TTHERM_00420020(protein)
MQQYFQVYYLVISTFFQKISRNFLINLFFQPSNMTNQASSNQLAPALGYQKIPVQQQHIK
KLTVDLLAGMITGWVSVITLQPLDMIKTTMQTSSNKQSILGCAKEIYQKSKMKGFYKGML
FPLIGSSFFSAIYYGSNEQMKKLICFLSNHKYDRTSLPLQYVFFSGSFAGLTTSCVSIPI
EHVKIRLQTQKNQQYTGSIDCFKKILRNHGVVGLYKSSILQLSRDFIGCGSFFVMYDITK
RYFKKQNNGELDKLRLFLSGCVAGMSYWPLCFPLDVIKTKMQSDSFVKPQFQNIKDCALQ
IYRYENRGFLNFYKGFLISNIRSIPNSAIALFTFENVLGFLSKLFGIQKPKH


>TTHERM_00420020(gene)
GTTCCTAAGTTTTAATGTAATAATATTTCTAAGTATATTATTTAGTAATTAGTACTTTCT
TTTAGAAAATTAGCAGAAATTTCCTAATTAATCTCTTTTTTCAGCCAAGCAATATGACAA
ACTAAGCAAGCAGCAATCAACTAGCCCCGGCTTTAGGATACCAAAAAATACCAGTCTAAT
AGTAACATATCAAGAAACTGACAGTAGATTTATTAGCAGGAATGATTACAGGTAACATTT
TTAAATAATCATATATTTATCCATAGGGATTTTACTATTGCAGTTAAAAAATAATTAGAA
CAAACTTATGACAAAAATTAAAATTATTTTATTGAATTTTTGTTTATGCCTTGTTTATTA
CTTTAAATTTAGGATGGGTTTCTGTAATAACCTTGCAACCTCTAGATATGATCAAAACAA
CCATGCAAACAAGCTCCAACAAACAAAGCATATTAGGTTGTGCAAAAGAAATATACTAAA
AGTCAAAAATGAAAGGTTTTTATAAGGGTAAATTAAAATTTAATATAGTATGAGAAATCT
TAATCTTTCTTATCAATAAAGGTATGCTCTTTCCTTTGATAGGCTCTAGCTTTTTTTCTG
CCATTTACTACGGTTCTAATGAATAGATGAAAAAATTAATATGCGTAATATAAAATAATA
TTTTTTATATGGATTATTAAAGCACACTTTCTTTAAATTAGCTTACTTATTTTATGATTT
TTAATTTTATATTATAAATTTTACAGTTTTTATCGAATCACAAGTATGATAGAACTAGCT
TGCCATTATAATATGTTTTCTTTTCAGGATCTTTTGCTGGTTTAACTACTTCATGTGTTT
CTATTCCTATAGAGCATGTAAAAATAAGACTATAAGTAGACCTTTATTAAATTTAATTTA
ATTAAGTTAAATAAACCTATTTAAATAAAATATTTAGACATAAAAAAACCAATAATATAC
TGGCTCAATTGATTGCTTTAAAAAGATATTAAGAAATCATGGTGTAGTAGGACTTTACAA
ATCATCTATCCTTTAATTATCAAGAGATTTTATAGGCTGTGGTAAGATAAATTTTTTTGG
TTATGAATTCAAATCATTTTTAATTGTTTAGGAAGCTTTTTTGTAATGTATGATATAACA
AAGAGATACTTCAAAAAGTAAAATAATGGAGAATTAGATAAATTAAGATTGTTTTTAAGT
GGGTGTGTAGCTGGAATGTCATATTGGCCTCTCTGCTTCCCACTAGATGTAATTAAAACA
AAAATGCAGAGTGATTCATTCGTTAAACCCTAATTTTAAAATATAAAAGACTGTGCTCTT
CAAATTTATAGATATGAAAATAGGGGATTTTTAAATTTTTATAAAGGATTTTTAATAAGT
AATATAAGATCTATTCCTAACTCAGCTATTGCACTTTTTACCTTTGAAAATGTTTTAGGA
TTTCTTTCTAAATTATTTGGAATTCAAAAACCCAAGCATTGAATTAAAGTGCTGCTAAAA
TATTATTTAATTTATGCTTTTCGTGTTTAATAAAAATAATTTATTTATTTTTTATAAATA
ATCATCATTTAATTAGAATTAAGATAAAGGCCATATGGCTTAAAATAAATTAACTTAATT
TGTATTCATGATAAGTTAATTAATTTGACCAAACATTGAAACTACACTAA