Identifiers and Description

Gene Model Identifier

TTHERM_00494720

Standard Name

MCF4 (Mitochondrial carrier family)

Aliases

PreTt04300 | 61.m00287 | 3711.m00134

Description

Mitochondrial carrier protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00153 ) Mitochondrial carrier protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00494720

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13060.19.997093137033517e-262mitochondrial carrier protein
(309 aa)
DictyBaseDDB_G02833332.9989272749380808e-50ucpB on chromosome: 4 position
469001 to 470093
OxytrichaContig6862.0.g216.001950283815408e-48Mitochondrial carrier protein
WormBaseWBGene000151861.999534248571833e-46locus:misc-1 status:Confirme
d UniProt:P90992 protein_i
d:CCD61938.1
SGDYLR348C2.9995979253168707e-35DIC1 Mitochondrial dicarboxyla
te carrier, integral membrane
protein, catalyzes a dicarboxy
late-phosphate exchange across
the inner mitochondrial membr
ane, transports cytoplasmic di
carboxylates into the mitochon
drial matrix
Stentor CoeruleusSteCoe_6511.462486227251231e-31

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00494720(coding)
ATGTCTTCCACACAAGTTTAGTAGAAAATCCCAACAATTTAAGATTATATACAAGCTTCT
CCTTTACCTCTTCTAGGATTTCTAGGAGGTTTAGCAGCTTCAACTGCCGAAACTCTTACT
TTTGCATTTGATAACATCAAGACACGTATGCAAATGAATGGAAAATAAGGAATGCCAACT
TATACTGGATTTGGAGATTGCATCAAAAAGACTTTGAATACTTCAGGCTTTAGAGGATTC
TATAAAGGTCTTTCAGCAGCACTCTTTAGACAAATCACTTATTCTAGCGTTAGAATGTGG
GTTTACGAAAACATCAAAAGAGCTTACTTCTAATCTGACCCCTCATTCTTAACTAAATTA
GCTGCTGGTGGCTTTGCTGGAGCTGTTGGATGCCTCGTTGGTACACCAGGGGATGTATTC
AAAATCCGTCTTATCAATGATATGCAAGGTTTAAAGTATAAAGGACTGATAGATTGCGCA
TAAAAAACTTTCTAAGCTGATGGCTATATGGGATTTTTAAAAGGGCTCAATGTTAACATC
GCCAGAGCAATAGTAGTTAACGCTGCTGAATTAGCAAGTTACGATTAAGCTAAAGGATTT
TTAGTTAATCAATGCTAATTAAGAAGCGATTCTCTCTGGACCCACTTCTTAGGTTCAACA
GCTGCTGGTTTTATGGGCGCAGTATGTAGTAGTCCGGTTGATGTCATTAAAACTAGATTT
ATGAATCAAGTCTCAACTGAAGGAGCGTTAGCATATAAATCTGCAACAGAATGCGGTTTA
AAAGTATTAAAGACAGAAGGATTTGGAGCCTTCTATAAAGGATTCTTAAGTTATTTCTTA
AGAATTGGACCCTGGAATGTATTTTTCTTTATGGCATACGAGTAATATAAAGCTTTCGCG
CTTCCAAGACTTGTTAAATTTTGA


>TTHERM_00494720(protein)
MSSTQVQQKIPTIQDYIQASPLPLLGFLGGLAASTAETLTFAFDNIKTRMQMNGKQGMPT
YTGFGDCIKKTLNTSGFRGFYKGLSAALFRQITYSSVRMWVYENIKRAYFQSDPSFLTKL
AAGGFAGAVGCLVGTPGDVFKIRLINDMQGLKYKGLIDCAQKTFQADGYMGFLKGLNVNI
ARAIVVNAAELASYDQAKGFLVNQCQLRSDSLWTHFLGSTAAGFMGAVCSSPVDVIKTRF
MNQVSTEGALAYKSATECGLKVLKTEGFGAFYKGFLSYFLRIGPWNVFFFMAYEQYKAFA
LPRLVKF


>TTHERM_00494720(gene)
ATGTCTTCCACACAAGTTTAGTAGAAAATCCCAACAATTTAAGATTATATACAAGCTTCT
CCTTTACCTCTTCTAGGATTTCTAGGAGGTTTAGCAGCTTCAACTGCCGAAACTCTTACT
TTTGCATTTGATAACATCAAGACACGTATGCAAATGAATGGAAAATAAGGAATGCCAACT
TATACTGGATTTGGAGATTGCATCAAAAAGACTTTGAATACTTCAGGCTTTAGAGGATTC
TATAAAGGTCTTTCAGCAGCACTCTTTAGACAAATCACTTATTCTAGCGTTAGAATGTGG
GTTTACGAAAACATCAAAAGAGCTTACTTCTAATCTGACCCCTCATTCTTAACTAAATTA
GCTGCTGGTGGCTTTGCTGGAGCTGTTGGATGCCTCGTTGGTACACCAGGGGATGTATTC
AAAATCCGTCTTATCAATGATATGCAAGGTACTAATTTTCGAAATCTAATTAATTCTTTC
GATTTCTTTATTTTGAAGTCCTTCTTTTTCACTATTTTTTTGATAACTCCTACAAGGGAC
TATCTATTTATATATCTTTAAATGTATGCTTGAAGTAAAAAGCATCAAAATATATTTTTA
CAAGTTTCCTATTTTTAAAACATTTTAAATTTGTATACTAATACAAAAATCAAACTAAAA
ATAAAAGGTTTAAAGTATAAAGGACTGATAGATTGCGCATAAAAAACTTTCTAAGCTGAT
GGCTATATGGGATTTTTAAAAGGGCTCAATGTTAACATCGCCAGAGCAATAGTAGTTAAC
GCTGCTGAATTAGCAAGTTACGATTAAGCTAAAGGATTTTTAGTTAATCAATGCTAATTA
AGAAGCGATTCTCTCTGGACCCACTTCTTAGGTTCAACAGCTGCTGGTAATGAATTATAT
AATTATTTTATTTTTTGCCATACTTAAAAAAATATGCAAAATATTTTTAAACACGCTAAA
CATAATATCAAAAAAAATTGCACAAATACATTCCCATTTTGGAAGCTTTATAAACCATAT
TGCAAACTAAAAACTGCTTTTAGGAAAAAAATAAAAGAAGAGGGATATTGTTCGCTTAGT
GATTCGCTAGTTTTTTTTATTTTTCTAAAGAAGATTCATATGAATATGTATTTTCTACTT
TATCGATATTAAAAATTTAGTGTTTCACTACTATTAATATATCGCGCATTATCCCTAATA
ATTGTTTGCTTTTTTGAGAGAATCGACGTAACAATTAACTTTTTTAAAAGTTAAGGAGCT
GATTATAAAATTAATAAAATCTTCACAAATTTTGTTGGATTAAGTTGAAAGATGTTTCTC
TAATTTTATTTGGAAACCTAACCCCTTTATTCAAGGCAAAATTTTGTAATTCAATATTTA
TGTAAAGGTGACGAAGTAATTATTTTCAGCAATTATCAGATATAAGATTCGGAAATTTGA
TTAATTGTTTTAAATATTTTGATAAATTTTTTATTCTAATTTGTGAAGAATATGTAAAGA
TAAAAAATCTTTTATATTTCTATGCCTTCATCATTCTTAAATATTTATCATCATCTAAAT
CATCAAGAATTACACCTTATATTAAATCATTATTTGAAAATTAAATCTAAATTTAGGTTT
TATGGGCGCAGTATGTAGTAGTCCGGTTGATGTCATTAAAACTAGATTTATGAATCAAGT
CTCAACTGAAGGAGCGTTAGCATATAAATCTGCAACAGAATGCGGTTTAAAAGTATTAAA
GACAGAAGGATTTGGAGCCTTCTATAAAGGATTCTTAAGTTATTTCTTAAGAATTGGACC
CTGGAATGTATTTTTCTTTATGGCATACGAGTAATATAAAGCTTTCGCGCTTCCAAGACT
TGTTAAATTTTGA