Identifiers and Description

Gene Model Identifier

TTHERM_00535730

Standard Name

MCF2 (Mitochondrial Carrier Family 2)

Aliases

PreTt03158 | 69.m00200 | 3718.m00062

Description

Mitochondrial carrier protein; facilitates transport across mitochondrial membranes

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00153 ) Mitochondrial carrier protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 19.7%

TetraMine Data

TTHERM_00535730

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11164.19.997093137033517e-262mitochondrial carrier protein
(305 aa)
OxytrichaContig22636.0.g492.000277046697593e-115Mitochondrial carrier protein
WormBaseWBGene000085059.996584278131743e-91Phosphate carrier protein, mit
ochondrial status:Confirmed
UniProt:P40614 protein_id:
CAA92769.1
SGDYER053C5.997798783616184e-81PIC2 Mitochondrial phosphate c
arrier, imports inorganic phos
phate into mitochondria; funct
ionally redundant with Mir1p b
ut less abundant than Mir1p un
der normal conditions; express
ion is induced at high tempera
ture
DictyBaseDDB_G02936464.001287313050914e-66mcfN on chromosome: 6 position
3201771 to 3203360
Stentor CoeruleusSteCoe_140611.2479464629129513e-47

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000204

Sequences

>TTHERM_00535730(coding)
ATGGGAGGTGATACTCACGATTTATCTTATTATGCTAAGTGTATGATGGGTGGTGTTTTG
GCTTGTGGACTCACTCACACAGCTATGGTACCTCTTGATGTAGTTAAATGCAAAAATCAA
GTTACAAAGGGATGGTCTTCCAGTCTAACCTAAGGGTTGACATAATTAAAAGCAGAAGGT
AGTCTTACATTAGGTTGGCTACCAACTCTTATAGGTTATTCACTTTAAGGTTTTGGTAAA
TATGGTTTTTATGAAATCTTTAAAGATGTCTACAAAGGTATCGTTGGTGAAGAAAATGCT
TAAAAGTACAGGAGAATAGGTTGGTCTATATCTTCAGGCTGTGCAGAAGTAATTGCTGAT
ACTTTATTATGCCCCTTCGAAACTATCAAGGTTTAGATGCAAACATCTTCAGGAGAAACT
GCATATCCTAAATCTTTTTTGCCAGCATACAATAAGTTTGTATCTGAGAATGGTTCTAAA
TCTTTATATAAAGTTTTACCTCCTCTTTGGGGGAGGTAAATCCCTTACACTATTGTTAAA
TTTGTTTCCTTCGAGTAAATTGTTGAACTTTTTTACAGCAAGGTCTTCACTAGACCAAAA
AGCGAATACTCTAAGGGATAATAATTATCTATCACTTTCTTATCAGGCTACTTGGCTGGT
ATTTTATGTGCTCTTGTTTCTCACCCTGCAGATACTATGGTCTCAAAAATGAATGCTCTT
GAATTCAAAGGTTAAGGAATAAGTGAGATTTATTCAAAAATTGGTTTCAGTGGACTTTGG
ACAGGTTTAGGAACCAGAATTATTATGATTGGTACTCTCACTGGTCTATAATGGTGGATT
TATGACAGCTTTAAGACTGCTGTTGGTCTTTAAGCATCAGGTGGATCTACTGCTCCAGTT
ACAAACAAACATTGA


>TTHERM_00535730(protein)
MGGDTHDLSYYAKCMMGGVLACGLTHTAMVPLDVVKCKNQVTKGWSSSLTQGLTQLKAEG
SLTLGWLPTLIGYSLQGFGKYGFYEIFKDVYKGIVGEENAQKYRRIGWSISSGCAEVIAD
TLLCPFETIKVQMQTSSGETAYPKSFLPAYNKFVSENGSKSLYKVLPPLWGRQIPYTIVK
FVSFEQIVELFYSKVFTRPKSEYSKGQQLSITFLSGYLAGILCALVSHPADTMVSKMNAL
EFKGQGISEIYSKIGFSGLWTGLGTRIIMIGTLTGLQWWIYDSFKTAVGLQASGGSTAPV
TNKH


>TTHERM_00535730(gene)
ATGGGAGGTGATACTCACGATTTATCTTATTATGCTAAGTGTATGATGGGTGGTGTTTTG
GCTTGTGGACTCACTCACACAGCTATGGTACCTCTTGATGTAGTTAAATGCAAAAATCAA
GTTACAAAGGGATGGTCTTCCAGTCTAACCTAAGGGTTGACATAATTAAAAGCAGAAGGT
AGTCTTACATTAGGTTGGCTACCAACTCTTATAGGTTATTCACTTTAAGGTTTTGGTAAA
TATGGTTTTTATGAAATCTTTAAAGATGTCTACAAAGGTATCGTTGGTGAAGAAAATGCT
TAAAAGTACAGGAGAATAGGTTGGTCTATATCTTCAGGCTGTGCAGAAGTAATTGCTGAT
ACTTTATTATGCCCCTTCGAAACTATCAAGGTTTAGATGCAAACATCTTCAGGAGAAACT
GCATATCCTAAATCTTTTTTGCCAGCATACAATAAGTTTGTATCTGAGAATGGTTCTAAA
TCTTTATATAAAGTTTTACCTCCTCTTTGGGGGAGGTAAATCCCTTACACTATTGTTAAA
TTTGTTTCCTTCGAGTAAATTGTTGAACTTTTTTACAGCAAGGTCTTCACTAGACCAAAA
AGCGAATACTCTAAGGGATAATAATTATCTATCACTTTCTTATCAGGCTACTTGGCTGGT
ATTTTATGTGCTCTTGTTTCTCACCCTGCAGATACTATGGTCTCAAAAATGAATGCTCTT
GAATTCAAAGGTTAAGGAATAAGTGAGATTTATTCAAAAATTGGTTTCAGTGGACTTTGG
ACAGGTTTAGGAACCAGAATTATTATGATTGGTACTCTCACTGGTCTATAATGGTGGATT
TATGACAGCTTTAAGACTGCTGTTGGTCTTTAAGCATCAGGTGGATCTACTGCTCCAGTT
ACAAACAAACATTGA