Identifiers and Description

Gene Model Identifier

TTHERM_00621600

Standard Name

MCF11 (Mitochondrial carrier family)

Aliases

PreTt05157 | 86.m00189

Description

Mitochondrial carrier protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00153 ) Mitochondrial carrier protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00621600

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03033.19.997093137033517e-262mitochondrial carrier protein
(319 aa)
OxytrichaContig13637.0.1.g279.000751454575209e-33Mitochondrial carrier protein
DictyBaseDDB_G02842254.998021988471165e-24ucpC on chromosome: 4 position
1714783 to 1716647
WormBaseWBGene000151862.000769134519826e-18locus:misc-1 status:Confirme
d UniProt:P90992 protein_i
d:CCD61938.1
Stentor CoeruleusSteCoe_271196.305116760146989e-16
SGDYEL006W0.0000000000010000211161514907YEA6 Putative mitochondrial NA
D+ transporter, member of the
mitochondrial carrier subfamil
y (see also YIA6); has putativ
e human ortholog

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00621600(coding)
ATGAATTACTCATACAAAAGATACTGGGAGCCCTCAACAGCTGAAGTAATCGGATTGTCA
TTATCTGTTAATACTATTTCAGCTGCCCTTACTTATCCTATCGAATTCGTTAAGGTAAGA
TCCCAAATTAGAACTGAAGGAGTTGGTATTCGTAGCAAGAACTTATACATGGGTATCAAT
CCCAACAAAGTATTCCGTGAGATTCATGCCACTGGTAACGGATTACGCGGTTTCTACCAA
GGTTTTGAGTCCCACTTAATTGGTCGTTTGAGCTACCTCTTCATCAGAAATCTTACCTAT
AAGATTATTTACGATAGAACCAAGCCAGTCAAGGCCCATAATGATCTTTCTCATAGAGAA
AAGGGTGTTATCGCTGGTTTTGCAGGTGGTTTGGCTGCATTTTTAACATCTCCTGCTGAT
TTAGTCAATACTCGTACCATCGCTGAAGGTGGTAAGCCCAAGGAATGGAGATGGGGATAT
AAAGGTTTAATGGACGGTATCAACAAGATTGCTGCCACTGAAGGTGGTAATGCCGCCCTC
TTCAGAGGTTCCTACGCCAACGTTCTTAGAGCCGTCATCCTTAACATCAGTTTGACTGGT
CCTTTTGATTATTTAAATGAAAAGATTTGGATTACTTTTGGTGATATGACCTGGAATAAA
TATGCTGCACTTCTCTGGGCCTCCTTCTGGGGTAGTGTTGCCACTCTTCCCTTCGATAAT
ATTAGAACTCGTCTCTATGCTCAAAACGCTGACCCTACTAAAAATAGATTAACTTATTCT
GGTTGGGCTGATGCTGCCAAAAAATTAATCTAACACGAAGGTATTAGCGGTTTCTATGTT
GGTTTCTACGCCTTCTACATTCGTACTTTCCTTTATGCTTGGACTACCGTTTTCATCACT
GATAAAATTACCTCTGACTGGAAGAGAAAGGCTGGCCTCAAGGAATGGCAAATTTGA


>TTHERM_00621600(protein)
MNYSYKRYWEPSTAEVIGLSLSVNTISAALTYPIEFVKVRSQIRTEGVGIRSKNLYMGIN
PNKVFREIHATGNGLRGFYQGFESHLIGRLSYLFIRNLTYKIIYDRTKPVKAHNDLSHRE
KGVIAGFAGGLAAFLTSPADLVNTRTIAEGGKPKEWRWGYKGLMDGINKIAATEGGNAAL
FRGSYANVLRAVILNISLTGPFDYLNEKIWITFGDMTWNKYAALLWASFWGSVATLPFDN
IRTRLYAQNADPTKNRLTYSGWADAAKKLIQHEGISGFYVGFYAFYIRTFLYAWTTVFIT
DKITSDWKRKAGLKEWQI


>TTHERM_00621600(gene)
ATGAATTACTCATACAAAAGATACTGGGAGCCCTCAACAGCTGAAGTAATCGGATTGTCA
TTATCTGTTAATACTATTTCAGCTGCCCTTACTTATCCTATCGAATTCGTTAAGGTAAGA
TCCCAAATTAGAACTGAAGGAGTTGGTATTCGTAGCAAGAACTTATACATGGGTATCAAT
CCCAACAAAGTATTCCGTGAGATTCATGCCACTGGTAACGGATTACGCGGTTTCTACCAA
GGTTTTGAGTCCCACTTAATTGGTCGTTTGAGCTACCTCTTCATCAGAAATCTTACCTAT
AAGATTATTTACGATAGAACCAAGCCAGTCAAGGCCCATAATGATCTTTCTCATAGAGAA
AAGGGTGTTATCGCTGGTTTTGCAGGTGGTTTGGCTGCATTTTTAACATCTCCTGCTGAT
TTAGTCAATACTCGTACCATCGCTGAAGGTGGTAAGCCCAAGGAATGGAGATGGGGATAT
AAAGGTTTAATGGACGGTATCAACAAGATTGCTGCCACTGAAGGTGGTAATGCCGCCCTC
TTCAGAGGTTCCTACGCCAACGTTCTTAGAGCCGTCATCCTTAACATCAGTTTGACTGGT
CCTTTTGATTATTTAAATGAAAAGATTTGGATTACTTTTGGTGATATGACCTGGAATAAA
TATGCTGCACTTCTCTGGGCCTCCTTCTGGGGTAGTGTTGCCACTCTTCCCTTCGATAAT
ATTAGAACTCGTCTCTATGCTCAAAACGCTGACCCTACTAAAAATAGATTAACTTATTCT
GGTTGGGCTGATGCTGCCAAAAAATTAATCTAACACGAAGGTATTAGCGGTTTCTATGTT
GGTTTCTACGCCTTCTACATTCGTACTTTCCTTTATGCTTGGACTACCGTTTTCATCACT
GATAAAATTACCTCTGACTGGAAGAGAAAGGCTGGCCTCAAGGAATGGCAAATTTGA