Identifiers and Description

Gene Model Identifier

TTHERM_01014550

Standard Name

MCF10 (Mitochondrial carrier family)

Aliases

PreTt04585 | 197.m00059 | 3748.m00295

Description

Mitochondrial carrier protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.8%

TetraMine Data

TTHERM_01014550

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20211.19.997093137033517e-262mitochondrial carrier protein
(309 aa)
SGDYNL003C6.996829646809514e-23PET8 S-adenosylmethionine tran
sporter of the mitochondrial i
nner membrane, member of the m
itochondrial carrier family; r
equired for biotin biosynthesi
s and respiratory growth
OxytrichaContig19158.0.0.g821.9991095569230066e-20Mitochondrial carrier protein
DictyBaseDDB_G02693945.000468829272308e-18mcfE on chromosome: 1 position
2699017 to 2700122
Stentor CoeruleusSteCoe_207610.000000000000012664165549094176
WormBaseWBGene000104590.0000000000002999981760818895status:Confirmed UniProt:Q21
084 protein_id:CAA88858.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000196

Sequences

>TTHERM_01014550(coding)
ATGGCAGCCATAGCTCAAGAAAAAACTCAACCTTAATACAATCCATTAAAGCTCGCAGCT
TGCAGCAGTTTAGGATATTGGATCGCTGATATGATTATGTATCCATTAGATACAATTAGT
ACTAAAATTAAGGCCCACACAGCAGAATTTTTATCATTTAAGCAAGGATATAAATAAGTT
ATTAAAGGAGAAGGATTCAAAGGAGTTTTTAGAGGATTTTCAACAACTTTTCCCTGCAGT
TTTGTACCCTCATTACTTTATTTCTCTTCATATGAGACTATGAATAAGTATGGTATGAGT
TTAATAAAAAAAGTATAAAATGAAAATATTTCAACTGCTTTAAAAATATGTATGCCTTTA
TTAACATCTTCTTTGGCTGAAATTGTCTGTTTAATCCCATACATGCCATTTGATGTCGTT
AGAACACGTCTTTAAGTGAATGATACAAACTTTTAATATACCAGTGTTTTATAAGGACTT
AAAGATGTATAACAAAAAGAAGGATTCTTGAGGCTCTACAAAGCCAGCCATATTTATATA
GCAACAACTACCATGCAAACAGGTCTATTGTTTTGGTTTTATGAAATGTAAAGATTTTTC
TTACTCCATAATACATAAAGCGAAGACGGTAGACATAAATTAACTATCAAATAAAGTATT
TTAGTCAGTTTATCCAGTTCTTTACTTTCTACTTTCATGGTTAACCCATTCGATTTAATT
TTGACTAGATATTAAGTTATTGATTCTAGTAAACAAAAACTATCTGTGAGAAAAATTACT
AAAGATTTAATTAAGAATGAAGGCTACATAGCTTTCTTCAAAGGATTAACACCTCGTCTA
TTAATTTCTTGTGCTAACTCAGTTCTATTTTTACCTGTTTATGAACACTTTAAAAGTCTC
TATGGAATAGATATAAGTGAAAATTGA


>TTHERM_01014550(protein)
MAAIAQEKTQPQYNPLKLAACSSLGYWIADMIMYPLDTISTKIKAHTAEFLSFKQGYKQV
IKGEGFKGVFRGFSTTFPCSFVPSLLYFSSYETMNKYGMSLIKKVQNENISTALKICMPL
LTSSLAEIVCLIPYMPFDVVRTRLQVNDTNFQYTSVLQGLKDVQQKEGFLRLYKASHIYI
ATTTMQTGLLFWFYEMQRFFLLHNTQSEDGRHKLTIKQSILVSLSSSLLSTFMVNPFDLI
LTRYQVIDSSKQKLSVRKITKDLIKNEGYIAFFKGLTPRLLISCANSVLFLPVYEHFKSL
YGIDISEN


>TTHERM_01014550(gene)
ATGGCAGCCATAGCTCAAGAAAAAACTCAACCTTAATACAATCCATGTAATTAATTAGCT
AATAATATTCTTCTTTATTTATTCAGATAATTGCCTAACAATTTTCTTAAATTTTTTTTT
TTTGCATGTAGTAAAGCTCGCAGCTTGCAGCAGTTTAGGATATTGGATCGCTGATATGAT
TATGTATCCATTAGATACAATTAGTACTAAAATTAAGGCCCACACAGCAGAATTTTTATC
ATTTAAGCAAGGATATAAATAAGTTATTAAAGGAGAAGGATTCAAAGGAGTTTTTAGAGG
ATTTTCAACAACTTTTCCCTGCAGTTTTGTACCCTCATTACTTTATTTCTCTTCATATGA
GACTATGAATAAGTATGGTATGAGTTTAATAAAAAAAGTATAAAATGAAAATATTTCAAC
TGCTTTAAAAATATGTATGCCTTTATTAACATCTTCTTTGGCTGAAATTGTCTGTTTAAT
CCCATACATGCCATTTGATGTCGTTAGAACACGTCTTTAAGTGAATGATACAAACTTTTA
ATATACCAGTGTTTTATAAGGACTTAAAGATGTATAACAAAAAGAAGGATTCTTGAGGCT
CTACAAAGCCAGCCATATTTATATAGCAACAACTACCATGCAAACAGGTCTATTGTTTTG
GTTTTATGAAATGTAAAGATTTTTCTTACTCCATAATACATAAAGCGAAGACGGTAGACA
TAAATTAACTATCAAATAAAGTATTTTAGTCAGTTTATCCAGTTCTTTACTTTCTACTTT
CATGGTTAACCCATTCGATTTAATTTTGACTAGATATTAAGTTATTGATTCTAGTAAACA
AAAACTATCTGTGAGAAAAATTACTAAAGATTTAATTAAGAATGAAGGCTACATAGCTTT
CTTCAAAGGATTAACACCTCGTCTATTAATTTCTTGTGCTAACTCAGTTCTATTTTTACC
TGTTTATGAACACTTTAAAAGTCTCTATGGAATAGATATAAGTGAAAATTGA