Identifiers and Description

Gene Model Identifier

TTHERM_00530730

Standard Name

MCF1 (Mitochondrial carrier family)

Aliases

PreTt04736 | 67.m00251 | 3684.m00121

Description

Mitochondrial carrier protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00153 ) Mitochondrial carrier protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.9%

TetraMine Data

TTHERM_00530730

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13581.19.997093137033517e-262mitochondrial carrier protein
(330 aa)
OxytrichaContig13881.0.g758.999119107228014e-72Mitochondrial carrier protein
DictyBaseDDB_G02693942.9993743585281133e-40mcfE on chromosome: 1 position
2699017 to 2700122
Stentor CoeruleusSteCoe_207613.3057006267607343e-37
SGDYMR166C1.9991517704232713e-32YMR166C Predicted transporter
of the mitochondrial inner mem
brane; has similarity to human
mitochondrial ATP-Mg/Pi carri
ers; YMR166C is not an essenti
al gene
WormBaseWBGene000112264.999723464643358e-28status:Confirmed UniProt:O62
347 protein_id:CAB04651.3

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00530730(coding)
ATGAGTGCTTAAAAAAAATAAAATATCTACGATGGCCCAGAATATGTTTACTATACTTTA
GCTGCAAGTACATTAGCAGGAATGACATCAAGGTGCTTTACTCACCCATTAGATACTTTA
AAAGCTAAACTTTAAGTTGAATCATCTAAATTTTACATCACATCAATAACGAAGCGCAAA
ATGTTATAGAAAATTACTTTTGATACATTTGCAAATGAAGGTATAAGAGGGTTTTTCAAA
GGAGTTGGGATATCTGTGTTAGGAACAGGCCCTGCTTTTGCATTATTTATGACCTCATAT
GAATACAGCAAGAAAAAATTCGAACAATATGATACATTTAAAAACAATGAATTTTTACTT
TACATGAGTGCAGGATTTAGTGCAGAATTAGTAAGCTGTCTTCTATGGCTACCTATTGAT
GTTATAAAAGAAAGGCTTTAGGTTTAGTCAAATTTAAAGCTTTATGAATATAAAAATTCT
ATTGATGCCATTAAATAAATATCAAAAGCTGAAGGAATATTAGGTCTTTATAAAGGTTAT
GGTGCAACTTTAGCTTCTTTTGGACCATATTCAGCTCTTTATTTTATGTTTTATGAGAAG
TTTAAAAAAGCAGTTTGTACAGACCCAAAAGCACCATCATTTTTTGAAAGTCTCACATTA
GCAGGTCTTGCAGGCTCAATAGCAAGTACATTAACAAATCCATTAGATGTATCAAAAGTT
AGAATTTAAGTTTAAAGAGCATAAAAATCCTTCTAAATATCCTCTGGAAACTCATATAGC
AATATAAGTAAAGAAGGTTATTTTGGATATAAAAATTTAGTACATGGACTTTATTTACTC
TTAAGACATGAAGGAATTGGGTCTATGTTTAAAGGTCTGAGTGCAAGATTATTAATGAAT
ACTCCACAAGCAGCTATTAGTATGAGCTTAACTGAAACTTTTAGAACATATTTAGTATAA
ATGACTAACAATTTTTAGCATTGA


>TTHERM_00530730(protein)
MSAQKKQNIYDGPEYVYYTLAASTLAGMTSRCFTHPLDTLKAKLQVESSKFYITSITKRK
MLQKITFDTFANEGIRGFFKGVGISVLGTGPAFALFMTSYEYSKKKFEQYDTFKNNEFLL
YMSAGFSAELVSCLLWLPIDVIKERLQVQSNLKLYEYKNSIDAIKQISKAEGILGLYKGY
GATLASFGPYSALYFMFYEKFKKAVCTDPKAPSFFESLTLAGLAGSIASTLTNPLDVSKV
RIQVQRAQKSFQISSGNSYSNISKEGYFGYKNLVHGLYLLLRHEGIGSMFKGLSARLLMN
TPQAAISMSLTETFRTYLVQMTNNFQH


>TTHERM_00530730(gene)
ATGAGTGCTTAAAAAAAATAAAATATCTACGATGGCCCAGAATATGTTTACTATACTTTA
GCTGCAAGTACATTAGCAGGAATGACATCAAGGTGCTTTACTCACCCATTAGATACTTTA
AAAGCTAAACTTTAAGTAACTTAATAATTTATATAATGAATGTGAGCAATCATAATTATA
AATTATAATTATTGAAAATAGGTTGAATCATCTAAATTTTACATCACATCAATAACGAAG
CGCAAAATGTTATAGAAAATTAGTATTTATCTATCTTTTAATAAAGCAAAATTGATAAAA
TTTTCTTTTTTTGATAATGAAAGCTTTTGATACATTTGCAAATGAAGGTATAAGAGGGTT
TTTCAAAGGAGTTGGGATATCTGTGGTAATATTTTTTTAAAAACAGCTGCTTAACTAATT
GTATTATTAAGTTAGGAACAGGCCCTGCTTTTGCATTATTTATGACCTCATATGAATACA
GCAAGAAAAAATTCGAACAATATGATGTAAGTTATAATTTTTAGTGTAAGCTTTTTTTGA
GATTGCTTAAAAAATAATTAAAATTATTTAGACATTTAAAAACAATGAATTTTTACTTTA
CATGAGTGCAGGATTTAGTGCAGAATTAGTAAGCTGTCTTCTATGGCTACCTATTGATGT
TATAAAAGAAAGGCTTTAGGTTTAGTCAAATTTAAAGCTTTATGAATATAAAAATTCTAT
TGATGCCATTAAATAAATATCAAAAGCTGAAGGAATATTAGGTCTTTATAAAGTAAAATA
AAATTGAGAAAAAAATAGCTTAAATTAATAAAATATTAATAAAAAAGGGTTATGGTGCAA
CTTTAGCTTCTTTTGGACCATATTCAGCTCTTTATTTTATGTTTTATGAGAAGTTTAAAA
GTAAAAAAGCAAAATATTTTATCAGTTTTTTATAAAATTTATTTTTTTTAAATTCAATAG
AAGCAGTTTGTACAGACCCAAAAGCACCATCATTTTTTGAAAGTCTCACATTAGCAGGTC
TTGCAGGCTCAATAGCAAGTACATTAACAAATCCATTAGATGTATCAAAAGTTAGAATTT
AAGTTTAAAGAGCATAAAAATCCTTCTAAATATCCTCTGGAAACTCATATAGCAATATAA
GTAAAGAAGGTTATTTTGGATATAAAAATTTAGTACATGGACTTTATTTACTCTTAAGAC
ATGAAGGAATTGGGTCTATGTTTAAAGGTAAAAATAATAAATAAAAATTTTATTTTAAAT
CAATTTAATTTTAAAAGGTCTGAGTGCAAGATTATTAATGAATACTCCACAAGCAGCTAT
TAGTATGAGCTTAACTGAAACTTTTAGAACATATTTAGTATAAATGACTAACAATTTTTA
GCATTGA