Identifiers and Description

Gene Model Identifier

TTHERM_00467500

Standard Name

MBD1 (Fusion of methylthioribulose-phosphate dehydratase and dihydroxy-keto-methylthiopentene dioxygenase)

Aliases

PreTt18652 | 55.m00207 | 3710.m00056

Description

Fusion of two genes involved in the methionine salvage pathway; methylthioribulose-1-phosphate dehydratase -mtnB; and 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase - mtnD

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF07883 ) Cupin domain
  • ( PF03079 ) ARD/ARD' family
  • ( TIGR01086 ) L-fuculose phosphate aldolase
  • ( TIGR00760 ) L-ribulose-5-phosphate 4-epimerase
  • ( TIGR03328 ) methylthioribulose-1-phosphate dehydratase
  • ( PF00596 ) Class II Aldolase and Adducin

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00467500

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15746.19.997093137033517e-262ARD/ARD family protein (401 aa
)
DictyBaseDDB_G02849154.99918933170902e-62DDB_G0284915 on chromosome: 4
position 2643291 to 2644175
SGDYJR024C6.001950283815408e-48MDE1 5-methylthioribulose-1-ph
osphate dehydratase; acts in t
he methionine salvage pathway;
potential Smt3p sumoylation s
ubstrate; expression downregul
ated by caspofungin and deleti
on mutant is caspofungin resis
tant
WormBaseWBGene000138706.0018235484001396e-36Probable methylthioribulose-1-
phosphate dehydratase status
:Confirmed UniProt:Q23261
protein_id:CAA88977.2

General Information

Paragraph NoGene NameParagraph Text
18MBD1MBD1 is a gene fusion of two genes involved in the methionine salvage pathway: methylthioribulose-1-phosphate dehydratase -mtnB; and 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase - mtnD. These enzymes catalyze non-consecutive steps in the pathway. Interestingly the gene that codes for the intervening enzyme in the pathway, mtnC, is missing from the genome of Tetrahymena. Complementation tests in yeast were used to show that MBD1 from Tetrahymena is able to do in one step what yeast does in three, since it can rescue yeast knockouts of mtnB, mtnC, or mtnD (Salim, Negritto and Cavalcanti 2009).

Associated Literature

  1. Ref:19851454: Salim HM, Negritto MC, Cavalcanti AR (2009) 1+1 = 3: a fusion of 2 enzymes in the methionine salvage pathway of Tetrahymena thermophila creates a trifunctional enzyme that catalyzes 3 steps in the pathway. PLoS genetics 5(10):e1000701

Sequences

>TTHERM_00467500(coding)
ATGAACGGTTTATCTTCAAATTCTGGTCCTAGAGAAGTCATTTGTGCTCTCTTGAGAAAC
TTTTATACTTAAGGATGGTGCGCTGGTTCAGGTGGTGGTATATCTATTAGAAAAAGCGAC
GATGAAATATATGTTGCACCTTCAGGTGTATAAAAAGAATTGGTTTAACCTGAAGATATC
TATGTTATTAATGTTAATGGAGATGTAGTTGAAAACCCTAAAAATCCAAAATTAAAACCT
TCTGAATGCACTCCTCTTTTTAATGCAGCTTATAAGCTTCGTCGTGCTGGTGCTGTTTTA
CATTCTCATGCTCTTCCTGCAATGCTAGTTACCAAGCTCTTTGGAACTGAATTTTAGACA
ATTGATCATGAAATGATTAAAGGTATTCCTAATCACCATAATACAGAATGGTGTGTCGTC
CCTATCATTGAAAACACTGAAAAGGAATGCGAATTAACAGAACGTTTAACTAATGCAATC
AACGCTTATCCTCGTTCTAATGCTGTCTTAGTTCGTAATCACGGTGTTTATATTTGGGGA
GAAAATTGGGAAAAAGCAAAAATACATGCTGAGTGTTACCATTATTTATTCGAAGCAGTT
GTTGAAATGAAGAAATTAGGTTTAGAAATTCCACGCACTGTTTCAAGCAGTAGCCAATTA
CGTGCTTGGTATATTGATGAAAATGCAATTGGCCAAGATGGTGATATTCGTGAGAGCTTA
CACTATCGCTCATATAAGTGGGTTAATCCAGAATATTTGGCAACAATTGGTGTTGAACAC
TGGAAATTAGACGGAGAAGAGAATAATACTGAACTTGAAAGAGTTTGCAAATAAAGAAAT
TACTCTTCTCGTGATTAAATTAAATGTGGAAATCATTGTGAAAATTACTAACAAATGTTA
TCAAATTTCAGAAAAGAACACATCCATTTAGATGAAGAGATTCGCTATATTATAGGTGGT
AGTGGTTATTTTGATGTCCGTGACCATGAAGATAAATGGATTCGTATCCAAAGTGTTAAA
GGTGATTTAATTGTACTTCCTGAAGGTATATATCACCGCTTTACAACTGATAAAAATGAT
GGAGTTCATGCTATGAGATTATTTAAGGATGAACCTAAATGGACACCTTATAATCGTCCT
TGTGATGAATTGGAAAGCCGTAACAAATATGTAGATTAATTCTTAAAAAAGTTTTAAAAA
TGA


>TTHERM_00467500(protein)
MNGLSSNSGPREVICALLRNFYTQGWCAGSGGGISIRKSDDEIYVAPSGVQKELVQPEDI
YVINVNGDVVENPKNPKLKPSECTPLFNAAYKLRRAGAVLHSHALPAMLVTKLFGTEFQT
IDHEMIKGIPNHHNTEWCVVPIIENTEKECELTERLTNAINAYPRSNAVLVRNHGVYIWG
ENWEKAKIHAECYHYLFEAVVEMKKLGLEIPRTVSSSSQLRAWYIDENAIGQDGDIRESL
HYRSYKWVNPEYLATIGVEHWKLDGEENNTELERVCKQRNYSSRDQIKCGNHCENYQQML
SNFRKEHIHLDEEIRYIIGGSGYFDVRDHEDKWIRIQSVKGDLIVLPEGIYHRFTTDKND
GVHAMRLFKDEPKWTPYNRPCDELESRNKYVDQFLKKFQK


>TTHERM_00467500(gene)
ATGAACGGTTTATCTTCAAATTCTGGTCCTAGAGAAGTCATTTGTGCTCTCTTGAGAAAC
TTTTATACTTAAGGATGGTGCGCTGGTTCAGGTGGTGGTATATCTATTAGAAAAAGCGAC
GATGAAATATATGTTGCACCTTCAGGTGTATAAAAAGAATTGGTTTAACCTGAAGATATC
TATGTTATTAATGTTAATGGAGATGTAGTTGAAAACCCTAAAAATCCAAAATTAAAACCT
TCTGAATGCACTCCTCTTTTTAATGCAGCTTATAAGCTTCGTCGTGCTGGTGCTGTTTTA
CATTCTCATGCTCTTCCTGCAATGCTAGTTACCAAGCTCTTTGGAACTGAATTTTAGACA
ATTGATCATGAAATGATTAAAGGTATTCCTAATCACCATAATACAGAATGGTGTGTCGTC
CCTATCATTGAAAACACTGAAAAGGAATGCGAATTAACAGAACGTTTAACTAATGCAATC
AACGCTTATCCTCGTTCTAATGCTGTCTTAGTTCGTAATCACGGTGTTTATATTTGGGGA
GAAAATTGGGAAAAAGCAAAAATACATGCTGAGTGTTACCATTATTTATTCGAAGCAGTT
GTTGAAATGAAGAAATTAGGTTTAGAAATTCCACGCACTGTTTCAAGCAGTAGCCAATTA
CGTGCTTGGTATATTGATGAAAATGCAATTGGCCAAGATGGTGATATTCGTGAGAGCTTA
CACTATCGCTCATATAAGTGGGTTAATCCAGAATATTTGGCAACAATTGGTGTTGAACAC
TGGAAATTAGACGGAGAAGAGAATAATACTGAACTTGAAAGAGTTTGCAAATAAAGAAAT
TACTCTTCTCGTGATTAAATTAAATGTGGAAATCATTGTGAAAATTACTAACAAATGTTA
TCAAATTTCAGAAAAGAACACATCCATTTAGATGAAGAGATTCGCTATATTATAGGTGGT
AGTGGTTATTTTGATGTCCGTGACCATGAAGATAAATGGATTCGTATCCAAAGTGTTAAA
GGTGATTTAATTGTACTTCCTGAAGGTATATATCACCGCTTTACAACTGATAAAAATGAT
GGAGTTCATGCTATGAGATTATTTAAGGATGAACCTAAATGGACACCTTATAATCGTCCT
TGTGATGAATTGGAAAGCCGTAACAAATATGTAGATTAATTCTTAAAAAAGTTTTAAAAA
TGA