Identifiers and Description

Gene Model Identifier

TTHERM_00722950

Standard Name

MAK1 (Fusion of methylthioribose kinase and methylthioribose-phosphate isomerase)

Aliases

PreTt18055 | 116.m00080 | 3671.m00004

Description

fusion of two genes in the methionine salvage pathway; methylthioribose kinase - MtnK - and methylthioribose phosphate isomerase - MtnA

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF01633 ) Choline/ethanolamine kinase
  • ( TIGR01767 ) 5-methylthioribose kinase
  • ( PF01636 ) Phosphotransferase enzyme family
  • ( PF01008 ) Initiation factor 2 subunit family
  • ( TIGR00512 ) S-methyl-5-thioribose-1-phosphate isomerase
  • ( TIGR00511 ) ribose-1,5-bisphosphate isomerase, e2b2 family
  • ( TIGR00524 ) eIF-2B alpha/beta/delta-related uncharacterized proteins

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00722950

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15751.19.997093137033517e-2625-methylthioribose kinase (780
aa)
WormBaseWBGene000072364.000392704867155e-81Methylthioribose-1-phosphate i
somerase status:Partially_co
nfirmed UniProt:Q93169 pro
tein_id:CAB02711.1
DictyBaseDDB_G02833092.000597631390999e-64DDB_G0283309 on chromosome: 4
position 511242 to 512282
SGDYPR118W7.998673901528599e-62MRI1 5-methylthioribose-1-phos
phate isomerase; catalyzes the
isomerization of 5-methylthio
ribose-1-phosphate to 5-methyl
thioribulose-1-phosphate in th
e methionine salvage pathway
OxytrichaContig21302.0.g10.00003998524687536623Initiation factor 2 subunit fa
mily

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:19851454: Salim HM, Negritto MC, Cavalcanti AR (2009) 1+1 = 3: a fusion of 2 enzymes in the methionine salvage pathway of Tetrahymena thermophila creates a trifunctional enzyme that catalyzes 3 steps in the pathway. PLoS genetics 5(10):e1000701

Sequences

>TTHERM_00722950(coding)
ATGGAAAAATTCCAAACATTTAGAAGAGAGGTAGATGACCACTTTTATGTTCTTGATTAG
CTTAAATTACCTTTAACAATTGAAGAGATCCGTATTAACACAATCGAAGATGCTTGGAAG
GTTATTAAAGATATGAATGTTCGTGGTGCTCCTCTGATTGCTGTAGTTGCTACTTAGGGT
TTACGTAACGAACTATTTAATAGAGACTTCAAGAGTGTCGAAGAGCTAAGAAAATATGTT
TTATAAGCAGTTGAGTATCTCCGTACTTCTCGCCCAACTGCAGTCAATTTGTAGAACGAT
ACAGAAAGAGTAAGGTAAACTGTCATAGATTTCAGCTTACAGCAAAGTGTTGAAGAAATT
TCATAATTGTAATAATTAAAGTAACAATTATTTTAGTTGATAGACTCTTTCAATTAGCAA
TACATCGATGCATGTAGACAAATGTCTATTCTTGGAGTTGATGCTATAATCAAAGACTTT
GAAGAAAAGCACCCTGAATAAGCAGGTTAAAATGCAAAGCTAAAAGTTTTAACCATTTGC
AATACTGGTAAGCTTGCTACTCCTGGTGATGGTACAGCATTAGGTATTGTTAGAGAGTTA
CATAGACGTGGGCGTTTAGAGAGGCTTTACATAGCTGAGACTAGACCTTATAACCAAGGA
GCTCGTTTAACAGCATCTGAAGCTGTTTTAGATAAACTTCCAGCAACTTTAATTACAGAC
AGCATGGCAGGTTTTTTGATGCAATAAGGTAACATCGATTTTGTTGTTGCAGGAGCTGAC
AGAGTAGCTAAAAATGGAGATACTGCTAATAAGATAGGAACATACACTTTTGCAGTTTTA
GCAAAGCACCATGATGTTAATTTCTATGTTGCCCTTCCCACCCAAACTATTGATGAAAAT
ACTTTATGTGGAGCAGATATCCATATTGAATAGCGCCCTAAGAATGAACTAACTCATGTG
ATGGGAGTTTAAATTGCCCCTACAGAAATTGAAGTTTGGAATCCATCATTTGATGTAACT
CCAAGCTCTCTCATCAAACGTATTTTCCATGAGGGTGGCGAATATGAGTGTGATAGAAGT
TAAGGAAATTGGAAATAGATGGATGCATAATCTTTAAAAAGTAACCTAATTAACAAATAT
AATGTATTTTCATAAGCTGAAGAGAGTTCTCTTTAGGTTTCTGAAATTGGAGATGGAAAC
TTGAATTTAGTTTTTATTGTTTCTACTGATCTTAAGCAAGTAATAGTCAAGCAAGCTTTA
CCTTATGTTCGTTGTGTAGGACCTACTTGGCCTTTTCCTCTCAATAGAGCTTTCTTTGAA
TACGAAGCACTAAAATTCCATAACTAAGTAGCTCCTGAATTGATTCCAAAGCCTCTCTTT
TTCGACAAAGATAACTCCTTAATAGTTATGGAATATTTAGCTCCTCCTTATATTATTCTT
AGAAAAGGTTTAATTCAACGCATAAAATATCCAAAATTAGCAAAAGATATAGCTATGTTC
TCTGCTAAAACACATTTTTACAGTAGCCCATTACATTTAGATAACAAAACTTATCGTGAA
AAGGTTAGTTTTTGGAGTGAAAATACAGAATTGTGTGCTTTGACAGAATAAGTTATCTTC
TCAGATCCTTATGTAGACTCTCACTATAACAAATGGACAACACCTCAATTAGACGATATA
GTTAAAACTATAAAAATTGCAGATGATGAATTAATAGTAGCTATTTCTGAGCTTCGTCAT
AAATTTATAACATCTAAGGAAGCTCTTATTCACGGTGATCTACATACAGGAAGTATAATG
GTCACAGAGAATGAAACTAGAGTTATTGACCCTGAATTTGCTTTTTATGGTCCAATAGGA
TTCGACACTGGCGCTTTTGTTGCTAATCTATTCTTGAATTTCTTTAGTTAAAAATAACAT
GAAAATGAAGTAAATTAAATTTCAGAATACTCTCAATGGCTTTTAGATACTACAGTTAGT
TTCTATACTTAATACGAAGAAGAGTTCTTAAATATCTGGAATACCAAATCAAATGTTTAA
AATGGTGGTGATTTCCCTCCAAACTTAATTAACAAAAATAATAACATCAAGATAGCAATT
TAAATAAAATACTTAAAAAATATTTTCTAAGACACACTAGGATTTGCTGCTGCAAAGATG
ATCAGAAGAATCATTGGAATAGCACACGTAGAAGATTTAGATTCCATATCAGATCTTGAT
GTTCGTTCTAAATGCGAAATAGCAGCTATAAAGTTTGCTAGATCTCTTATGGTTAATAGA
AATTAGTTCAAGAATATTTAAGAAGTTGTAGATTTGGCTAAAGTTTATTACACTTAATGA


>TTHERM_00722950(protein)
MEKFQTFRREVDDHFYVLDQLKLPLTIEEIRINTIEDAWKVIKDMNVRGAPLIAVVATQG
LRNELFNRDFKSVEELRKYVLQAVEYLRTSRPTAVNLQNDTERVRQTVIDFSLQQSVEEI
SQLQQLKQQLFQLIDSFNQQYIDACRQMSILGVDAIIKDFEEKHPEQAGQNAKLKVLTIC
NTGKLATPGDGTALGIVRELHRRGRLERLYIAETRPYNQGARLTASEAVLDKLPATLITD
SMAGFLMQQGNIDFVVAGADRVAKNGDTANKIGTYTFAVLAKHHDVNFYVALPTQTIDEN
TLCGADIHIEQRPKNELTHVMGVQIAPTEIEVWNPSFDVTPSSLIKRIFHEGGEYECDRS
QGNWKQMDAQSLKSNLINKYNVFSQAEESSLQVSEIGDGNLNLVFIVSTDLKQVIVKQAL
PYVRCVGPTWPFPLNRAFFEYEALKFHNQVAPELIPKPLFFDKDNSLIVMEYLAPPYIIL
RKGLIQRIKYPKLAKDIAMFSAKTHFYSSPLHLDNKTYREKVSFWSENTELCALTEQVIF
SDPYVDSHYNKWTTPQLDDIVKTIKIADDELIVAISELRHKFITSKEALIHGDLHTGSIM
VTENETRVIDPEFAFYGPIGFDTGAFVANLFLNFFSQKQHENEVNQISEYSQWLLDTTVS
FYTQYEEEFLNIWNTKSNVQNGGDFPPNLINKNNNIKIAIQIKYLKNIFQDTLGFAAAKM
IRRIIGIAHVEDLDSISDLDVRSKCEIAAIKFARSLMVNRNQFKNIQEVVDLAKVYYTQ


>TTHERM_00722950(gene)
ATGGAAAAATTCCAAACATTTAGAAGAGAGGTAGATGACCACTTTTATGTTCTTGATTAG
CTTAAATTACCTTTAACAATTGAAGAGATCCGTATTAACACAATCGAAGATGCTTGGAAG
GTTATTAAAGATATGAATGTTCGTGGTGCTCCTCTGATTGCTGTAGTTGCTACTTAGGGT
TTACGTAACGAACTATTTAATAGAGACTTCAAGAGTGTCGAAGAGCTAAGAAAATATGTT
TTATAAGCAGTTGAGTATCTCCGTACTTCTCGCCCAACTGCAGTCAATTTGTAGAACGAT
ACAGAAAGAGTAAGGTAAACTGTCATAGATTTCAGCTTACAGCAAAGTGTTGAAGAAATT
TCATAATTGTAATAATTAAAGTAACAATTATTTTAGTTGATAGACTCTTTCAATTAGCAA
TACATCGATGCATGTAGACAAATGTCTATTCTTGGAGTTGATGCTATAATCAAAGACTTT
GAAGAAAAGCACCCTGAATAAGCAGGTTAAAATGCAAAGCTAAAAGTTTTAACCATTTGC
AATACTGGTAAGCTTGCTACTCCTGGTGATGGTACAGCATTAGGTATTGTTAGAGAGTTA
CATAGACGTGGGCGTTTAGAGAGGCTTTACATAGCTGAGACTAGACCTTATAACCAAGGA
GCTCGTTTAACAGCATCTGAAGCTGTTTTAGATAAACTTCCAGCAACTTTAATTACAGAC
AGCATGGCAGGTTTTTTGATGCAATAAGGTAACATCGATTTTGTTGTTGCAGGAGCTGAC
AGAGTAGCTAAAAATGGAGATACTGCTAATAAGATAGGTAAAATTGAAAATTATTTTTAT
AAATACAACAGTTTTTATAACCTTGATTTTATACAAAGTAAAATGAATTACTAAACAAAT
TTAAAAAGAGACAAAAAGATATTTATTTATTGCTTCTGTTTAATTATAAAAAACACTTAT
TTTATATTTAATTAAAAACGTATTAATAATTTCTTTTATTTTAGGAACATACACTTTTGC
AGTTTTAGCAAAGCACCATGATGTTAATTTCTATGTTGCCCTTCCCACCCAAACTATTGA
TGAAAATACTTTATGTGGAGCAGATATCCATATTGAATAGCGCCCTAAGAATGAACTAAC
TCATGTGATGGGAGTTTAAATTGCCCCTACAGAAATTGAAGTTTGGAATCCATCATTTGA
TGTAACTCCAAGCTCTCTCATCAAACGTATTTTCCATGAGGGTGGCGAATATGAGTGTGA
TAGAAGTTAAGGAAATTGGAAATAGATGGATGCATAATCTTTAAAAAGTAACCTAATTAA
CAAATATAATGTATTTTCATAAGCTGAAGAGAGTTCTCTTTAGGTTTCTGAAATTGGAGA
TGGAAACTTGAATTTAGTTTTTATTGTTTCTACTGATCTTAAGCAAGTAATAGTCAAGCA
AGCTTTACCTTATGTTCGTTGTGTAGGACCTACTTGGCCTTTTCCTCTCAATAGAGCTTT
CTTTGAATACGAAGCACTAAAATTCCATAACTAAGTAGCTCCTGAATTGATTCCAAAGCC
TCTCTTTTTCGACAAAGATAACTCCTTAATAGTTATGGAATATTTAGCTCCTCCTTATAT
TATTCTTAGAAAAGGTTTAATTCAACGCATAAAATATCCAAAATTAGCAAAAGATATAGC
TATGTTCTCTGCTAAAACACATTTTTACAGTAGCCCATTACATTTAGATAACAAAACTTA
TCGTGAAAAGGTTAGTTTTTGGAGTGAAAATACAGAATTGTGTGCTTTGACAGAATAAGT
TATCTTCTCAGATCCTTATGTAGACTCTCACTATAACAAATGGACAACACCTCAATTAGA
CGATATAGTTAAAACTATAAAAATTGCAGATGATGAATTAATAGTAGCTATTTCTGAGCT
TCGTCATAAATTTATAACATCTAAGGAAGCTCTTATTCACGGTGATCTACATACAGGAAG
TATAATGGTCACAGAGAATGAAACTAGAGTTATTGACCCTGAATTTGCTTTTTATGGTCC
AATAGGATTCGACACTGGCGCTTTTGTTGCTAATCTATTCTTGAATTTCTTTAGTTAAAA
ATAACATGAAAATGAAGTAAATTAAATTTCAGAATACTCTCAATGGCTTTTAGATACTAC
AGTTAGTTTCTATACTTAATACGAAGAAGAGTTCTTAAATATCTGGAATACCAAATCAAA
TGTTTAAAATGGTGGTGATTTCCCTCCAAACTTAATTAACAAAAATAATAACATCAAGAT
AGCAATTTAAATAAAATACTTAAAAAATATTTTCTAAGACACACTAGGATTTGCTGCTGC
AAAGATGATCAGAAGAATCATTGGAATAGCACACGTAGAAGATTTAGATTCCATATCAGA
TCTTGATGTTCGTTCTAAATGCGAAATAGCAGCTATAAAGTTTGCTAGATCTCTTATGGT
TAATAGAAATTAGTTCAAGAATATTTAAGAAGTTGTAGATTTGGCTAAAGTTTATTACAC
TTAATGA