Identifiers and Description

Gene Model Identifier

TTHERM_00575390

Standard Name

MAI63 (Maleylacetoacetate isomerase, TtMAAI1, MAAI1)

Aliases

PreTt28929 | 77.m00141 | 3812.m02624

Description

maleylacetoacetate isomerase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00575390

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04003.11.0000198575659891e-106maleylacetoacetate isomerase (
221 aa)
WormBaseWBGene000017902.0008958828286524e-54locus:gst-42 Probable maleyl
acetoacetate isomerase statu
s:Confirmed UniProt:Q18938
protein_id:CAA91449.1
DictyBaseDDB_G02781554.000521932330652e-52mai on chromosome: 3 position
376116 to 376878
OxytrichaContig3598.0.1.g924.0017993270483566e-44Glutathione S-transferase, C-t
erminal domain
Stentor CoeruleusSteCoe_202241.4251640827409352e-21
SGDYLL060C0.0002999184360822198GTT2 Glutathione S-transferase
capable of homodimerization;
functional overlap with Gtt2p,
Grx1p, and Grx2p

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00575390(coding)
ATGAGTGAAAATAATTAAAATATTATCCTTTATGGCAATTACCGTTCTTCACCTTCTTGG
CGAGTAAGATTAGCACTTGGTTTAAAAAAGATAGAATACAAATTAGTTTCAATTGACCTT
TTTAAAAATGAGTAAAAATCTGAAGTATACTTCAAGGTTAATCCAAATTAACGTATCCCT
GCTCTTATATATGGAGATCAAACATTGATAGAAAGCACTGCAATAATCGAGTTCTTAGAA
GAAAATTTTCCTTAGTATCCTTTACTTCCCGAGGATAGAATTAAGAGAGCTTAGATTAGA
GGCTTTTGCTAAGTCATAAACAGTGCTATTCATCCCTATTAGAATTCAAATTTAATAGGA
AAAATTGAAAAAGAAGGCAATATGAATAAGTTAGAATGGATTAAATTCTGGGTGACTAAG
GGGTTGACAGCTATAGAAGAACTTTTGAAGAAATATCATGGAAAATTTTGCTTTGGTGAT
GATATAACGATGGCAGATATTTTCTTAATCCCTTAAGTATCTGCAGTAGTAGAAAGATTT
GGATTCGATTTAACACCTTTTCCTCTTATCTTAAGTGTTGTAAATAACTTAAAGGATCTT
CCAGAATTTATTGCTGCTTCCCCTAGTAATTAACCAGATTATACTGAATAAAAAAATTGA


>TTHERM_00575390(protein)
MSENNQNIILYGNYRSSPSWRVRLALGLKKIEYKLVSIDLFKNEQKSEVYFKVNPNQRIP
ALIYGDQTLIESTAIIEFLEENFPQYPLLPEDRIKRAQIRGFCQVINSAIHPYQNSNLIG
KIEKEGNMNKLEWIKFWVTKGLTAIEELLKKYHGKFCFGDDITMADIFLIPQVSAVVERF
GFDLTPFPLILSVVNNLKDLPEFIAASPSNQPDYTEQKN


>TTHERM_00575390(gene)
ATGAGTGAAAATAATTAAAATATTATCCTTTATGGCAATTACCGTTCTTCACCTTCTTGG
CGAGTAAGATTAGCACTTGGTTTAAAAAAGATAGAATACAAATTAGTTTCAATTGACCTT
TTTAAAAATGAGTAAAAATCTGAAGTATACTTCAAGGTTAATCCAAATTAAGTAAATTAA
TTTTTCTCAAATATTATATTAATTTTGAAGTAATTTATCTATAAAGCGTATCCCTGCTCT
TATATATGGAGATCAAACATTGATAGAAAGCACTGCAATAATCGAGTTCTTAGAAGAAAA
TTTTCCTTAGTATCCTTTACTTCCCGAGGATAGAATTAAGAGAGCTTAGATTAGAGGCTT
TTGCTAAGTCATAAACAGTGCTATTCATCCCTATTAGAATTCAAATTTAATAGGAAAAAT
TGAAAAAGAAGGCAATATGAATAAGTTAGAATGGATTAAATTCTGGGTGACTAAGGGGTT
GACAGGTAAACAAATAATTCTTTTTCTATAATTTTTTTAATAAATAATATTCTTATATTT
CAGCTATAGAAGAACTTTTGAAGAAATATCATGGAAAATTTTGCTTTGGTGATGATATAA
CGATGGCAGATATTTTCTTAATCCCTTAAGTATCTGCAGTAGTAGAAAGATTTGGATTCG
ATTTAACACCTTTTCCTCTTATCTTAAGTGTTGTAAATAACTTAAAGGATCTTCCAGAAT
TTATTGCTGCTTCCCCTAGTAATTAACCAGATTATACTGAATAAAAAAATTGA