Identifiers and Description

Gene Model Identifier

TTHERM_00476690

Standard Name

MAG1 (Mago nashi protein 1)

Aliases

PreTt06198 | 58.m00170 | 3719.m00030

Description

Members of this family, which was originally identified in Drosophila and called mago nashi, are integral members of the exon junction complex (EJC).

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00476690

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14168.14.000984052615602e-165hypothetical protein (710 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00476690(coding)
ATGACGGAAATGAATGAGCTGGACACAATTTTCAGGATCCTTTTCTGCACAATTTAGATC
CTCTTTTTGAAATACATTTATTATAGGCATTAGAGACAGGGTTTCATGAAGTATATGAGA
GAAAAATTACAATATGAATTGATTGATCAAATCATCCCTATGCAATTATTTGTCATTAAT
TATAATCCCATAACACAAAGAATTGAGTTAGTAGATAGTAACATCAGAGCAAAGCAAGTT
AACTAAATTAGTTCTGATGATAAACTTGATATATTTATGCAATCAGCTCAGCTGAATTTC
ACTGAAAAATAAAAAAAGAAAATTATTACTCTTAAGCACTTTCTTTTGGAAATGTTCATA
AAACTAGATAATAAAAAGTAGACTTTTTAAGAGATATTCAAGAATTCCAAAGAATTTAAT
AAAATAATTGCTTATCAAGTGAACAAGGATGGTGGAAATACAGTCGGTAAATATAAAATA
AAATTGTTTCCAAGAGGGAAAAAAAATAACTAAATTGTTGTAGCTTTAGAAGATCTTAGT
CAGATTGAGGAGCTTAAACTAGTAAAATAAAAGGCAAAATAGGCTGATTAGCATCTTTAA
ATTTTTTTTGAGTACTTCAAATAGAAGTTTGCTAGGATTTTTCATACTATTGACATTTCG
TGTTCTATGAAAATAGAAGATCCTATGGTAGAACTTATGTAGGCAAAAAGAATTACAACT
AAACTATATTCTACTGTCCAGAATATTGCTGCATTTAGAAAATAAGATAATGATGAATAA
GGAACATATAACGCATAAAGATTCAGCAAAAGAGTTAGAATGAAATCACTTAATCCATCT
AGCGTTTCATAGTTCAATTTCAATAACTTAATTGACGATGTCAAAAATATTTATCCTGAT
TTTTTCAATTCATACAGCTATGAAACTCATTCTAATTCCTCTTCTTAAAACTAAATATAA
ATTTACAGTGATAATGAAAAAATGAAATCAATTTTTATTACTCTGCTTAATTAAATTGAA
GAATGTTTACCTGAAAAATACTTCAAAGGATTGAAGGTCTCTTTTACCGAAGAAAAGGAG
ACGCATTTTGAATTTATAAAGGTCAAGATATAATTTTAAGTGCACAATGATTGTGTTCAG
AATACATAGCTAAAAGATGCTTCTTTTTTTCAGCTTGAAAAAGAAAATAAAAAAATTGAT
TCCTATGAAATACTTAAATAGCTGCTATGCTATTACAATTCAGATAATGATGAAATAAGA
GATATAGAAATAGCTATGATAAAATTCTATCTGTCTTAGATAAGTCCTTATGAAATGGAA
ATCAAAGAAGAAGCTATTGAACAAGAATTCTAACGACTTCTCTCAAATAGTCTTATTGGA
AATATGTAAAAAGATCATAATTAAATAAGCGAGCTAGACTCAATTAAAAATACAACTTAG
AATCAAGAATTTCATTATTATTAGATGCCATCGAATAGATAAGTCGATGGTATAGAAACT
ACTCCTTAATCTTTCATTTCAACAAACAGACAGAATGAATTCGAAAATGATTTACTTTCG
CAAGAATTAGTCAGAAACACCAATAAGAAACTAAACCAAGATACTTTTATATCAGAAAAT
GAAAACAATAAAAATCAAATTTAGTATATTAGTAACAATATCTAACATAATATTAGTAAC
ACAATTGAAGGTAAAGTGGATGTAGAACTTACAAAAAGACAATCTTTCAAAAGAGTTAAT
CAAAAAAAGCTTTCCTAATTTCACAGACAAACTAAATAGCATTCTATCGACTATAAAGAA
CATAAAAATATTATACTTTCTATGACATTTTTTAAAGATATCAGAGTTATTTTAGAATTA
AACTTAAGATAAAATAGTTAGGCTTCTAATAATAATAATAATAATAATAATAATACTAAT
AATAATTAAAACTACTTAGATTTAAAATCTAGATAAAATTCAACATATTCTTACAATAAA
GGCAATACAAATTTTAATTAAACTGATATGAACCTGTTGCCAACTATGTAATTTATTCCA
AAGCAATCAATCTTAAAAAAAAATTCTATGTAAAGCAATTAGTCTCCTATGTCCTCTCCT
ACTCAAATCAAAAGATTACTTAAAAACAATTCATTAGTTTCAAACATTAATATTTTTAAT
AATCCAAATAAAATTCGTTCTAACACATCTATAGATGATACAGGAGAATCAAAATAATAA
AAATTAATTCCATTTTTTGAAATTCATACACTAAAGAAATTGTAATAATAAAACGAAAAA
ATTAATAAAATTAAATAAAACTTAACTAATGTAACAATCTAATTAAAGTAAAAAGATAAT
ATTTCTGATCTATGA


>TTHERM_00476690(protein)
MTEMNELDTIFRILFCTIQILFLKYIYYRHQRQGFMKYMREKLQYELIDQIIPMQLFVIN
YNPITQRIELVDSNIRAKQVNQISSDDKLDIFMQSAQLNFTEKQKKKIITLKHFLLEMFI
KLDNKKQTFQEIFKNSKEFNKIIAYQVNKDGGNTVGKYKIKLFPRGKKNNQIVVALEDLS
QIEELKLVKQKAKQADQHLQIFFEYFKQKFARIFHTIDISCSMKIEDPMVELMQAKRITT
KLYSTVQNIAAFRKQDNDEQGTYNAQRFSKRVRMKSLNPSSVSQFNFNNLIDDVKNIYPD
FFNSYSYETHSNSSSQNQIQIYSDNEKMKSIFITLLNQIEECLPEKYFKGLKVSFTEEKE
THFEFIKVKIQFQVHNDCVQNTQLKDASFFQLEKENKKIDSYEILKQLLCYYNSDNDEIR
DIEIAMIKFYLSQISPYEMEIKEEAIEQEFQRLLSNSLIGNMQKDHNQISELDSIKNTTQ
NQEFHYYQMPSNRQVDGIETTPQSFISTNRQNEFENDLLSQELVRNTNKKLNQDTFISEN
ENNKNQIQYISNNIQHNISNTIEGKVDVELTKRQSFKRVNQKKLSQFHRQTKQHSIDYKE
HKNIILSMTFFKDIRVILELNLRQNSQASNNNNNNNNNTNNNQNYLDLKSRQNSTYSYNK
GNTNFNQTDMNLLPTMQFIPKQSILKKNSMQSNQSPMSSPTQIKRLLKNNSLVSNINIFN
NPNKIRSNTSIDDTGESKQQKLIPFFEIHTLKKLQQQNEKINKIKQNLTNVTIQLKQKDN
ISDL


>TTHERM_00476690(gene)
AATTTGTATACGATGTTTGTGTAATTTTGATAAGCTAATTCAGCCTATTTTTTATGACGG
AAATGAATGAGCTGGACACAATTTTCAGGATCCTTTTCTGCACAATTTAGATCCTCTTTT
TGAAATACATTTATTATAGGCATTAGAGACAGGGTTTCATGAAGTATATGAGAGAAAAAT
TACAATATGAATTGATTGATCAAATCATCCCTATGCAATTATTTGTCATTAATTATAATC
CCATAACACAAAGAATTGAGTTAGTAGGTAATTTATTTTTTTATTAATTAATTAATTTTT
TTATACAAATCTAATATCAATCACATAATTAATAAACGCAAAATAAATTACCTTAATTTT
TTAATCATATTTCATTTAAGTTTTATCCCTTAAAACTAAACAAAAATTAATGTATCAAAA
AAGCAAACTTATCTATTTTAGCTTAATATTATTTTTTTTAATGAAAGAAGTAGCTTTTAA
ATGGCATATATATCTCTTATATGCTTTGATTGATCACATAGACTTTTCAAATATTTTTAT
TGATTGAATTTCTAAAATTTTAAACAATAATTAAGAATATTGCCATTCTTTCCTACTAAT
TTTTTGATATTAGCCAATTTTTTTGATGTTTGAAATTCTTTTTTAAGTGTTAAGATATAA
ATATTTATATATATTTTTTTTTGTGATAATTATGATAAAGTAATGAATTTTTATTTCAAT
TGTAGATAGTAACATCAGAGCAAAGCAAGTTAACTAAATTAGTTCTGATGATAAACTTGA
TATATTTATGCAATCAGCTCAGCTGAATTTCACTGAAAAATAAAAAAAGAAAATTATTAC
TCTTAAGCACTTTCTTTTGGAAATGTTCATAAAACTAGATAATAAAAAGTAGACTTTTTA
AGAGATATTCAAGAATTCCAAAGAATTTAATAAAATAATTGCTTATCAAGTGAACAAGGA
TGGTGGAAATACAGTCGGTAAATATAAAGTAAGAAGTTAATGTTTTTAATAATTATTTCT
AAATTTTGATAGATTTTGTTTTATTTAAAAATAGATAAAATTGTTTCCAAGAGGGAAAAA
AAATAACTAAATTGTTGTAGCTTTAGAAGATCTTAGTCAGATTGAGGAGCTTAAACTAGT
AAAATAAAAGGCAAAATAGGCTGATTAGCATCTTTAAATTTTTTTTGAGTACTTCAAATA
GAAGTTTGCTAGGATTTTTCATACTATTGACATTTCGTGTTCTATGAAAATAGAAGATCC
TATGGTAGAACTTATGTAGGCAAAAAGAATTACAACTAAACTATATTCTACTGTCCAGAA
TATTGCTGCATTTAGAAAATAAGATAATGATGAATAAGGAACATATAACGCATAAAGATT
CAGCAAAAGAGTTAGAATGAAATCACTTAATCCATCTAGCGTTTCATAGTTCAATTTCAA
TAACTTAATTGACGATGTCAAAAATATTTATCCTGATTTTTTCAATTCATACAGCTATGA
AACTCATTCTAATTCCTCTTCTTAAAACTAAATATAAATTTACAGTGATAATGAAAAAAT
GAAATCAATTTTTATTACTCTGCTTAATTAAATTGAAGAATGTTTACCTGAAAAATACTT
CAAAGGATTGAAGGTCTCTTTTACCGAAGAAAAGGAGACGCATTTTGAATTTATAAAGGT
CAAGATATAATTTTAAGTGCACAATGATTGTGTTCAGAATACATAGCTAAAAGATGCTTC
TTTTTTTCAGCTTGAAAAAGAAAATAAAAAAATTGATTCCTATGAAATACTTAAATAGCT
GCTATGCTATTACAATTCAGATAATGATGAAATAAGAGATATAGAAATAGCTATGATAAA
ATTCTATCTGTCTTAGATAAGTCCTTATGAAATGGAAATCAAAGAAGAAGCTATTGAACA
AGAATTCTAACGACTTCTCTCAAATAGTCTTATTGGAAATATGTAAAAAGATCATAATTA
AATAAGCGAGCTAGACTCAATTAAAAATACAACTTAGAATCAAGAATTTCATTATTATTA
GATGCCATCGAATAGATAAGTCGATGGTATAGAAACTACTCCTTAATCTTTCATTTCAAC
AAACAGACAGAATGAATTCGAAAATGATTTACTTTCGCAAGAATTAGTCAGAAACACCAA
TAAGAAACTAAACCAAGATACTTTTATATCAGAAAATGAAAACAATAAAAATCAAATTTA
GTATATTAGTAACAATATCTAACATAATATTAGTAACACAATTGAAGGTAAAGTGGATGT
AGAACTTACAAAAAGACAATCTTTCAAAAGAGTTAATCAAAAAAAGCTTTCCTAATTTCA
CAGACAAACTAAATAGCATTCTATCGACTATAAAGAACATAAAAATATTATACTTTCTAT
GACATTTTTTAAAGATATCAGAGTTATTTTAGAATTAAACTTAAGATAAAATAGTTAGGC
TTCTAATAATAATAATAATAATAATAATAATACTAATAATAATTAAAACTACTTAGATTT
AAAATCTAGATAAAATTCAACATATTCTTACAATAAAGGCAATACAAATTTTAATTAAAC
TGATATGAACCTGTTGCCAACTATGTAATTTATTCCAAAGCAATCAATCTTAAAAAAAAA
TTCTATGTAAAGCAATTAGTCTCCTATGTCCTCTCCTACTCAAATCAAAAGATTACTTAA
AAACAATTCATTAGTTTCAAACATTAATATTTTTAATAATCCAAATAAAATTCGTTCTAA
CACATCTATAGATGATACAGGAGAATCAAAATAATAAAAATTAATTCCATTTTTTGAAAT
TCATACACTAAAGAAATTGTAATAATAAAACGAAAAAATTAATAAAATTAAATAAAACTT
AACTAATGTAACAATCTAATTAAAGTAAAAAGATAATATTTCTGATCTATGAAAATATCA
AAG