Identifiers and Description

Gene Model Identifier

TTHERM_01093530

Standard Name

MAF4 (membrane flagellar associated protein 4)

Aliases

PreTt16926 | 230.m00035 | 3806.m00216

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01093530

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_213000
WormBaseWBGene000011189.997093137033517e-262locus:dyf-2 status:Confirmed
UniProt:G5ECZ4 protein_id
:CAL49447.1
Tetrahymena borealisEI9_20568.19.997093137033517e-262hypothetical protein (1388 aa)
OxytrichaContig889.1.g689.997093137033517e-262Region in Clathrin and VPS

General Information

Paragraph NoGene NameParagraph Text
29MAF4Tetrahymena thermophila MAF4 is homologous with proteins from the WD40 superfamily, mostly membrane and flagellar associated proteins. It contains two domains; the first domain (E-value=1.95E-5), in the clathrin family, indicates that the protein could have a membrane spanning domain due to repeated alpha-helices. The second domain (E-value=7.46E-3) is a kinase complex, which indicates possible movement function, and correlates with the homologs being flagellar associated proteins. It is possible that this protein is an integral membrane protein that has a function in flagellar movement. Paragraph by: Lauren Mitten and Rebecca Dutta (undergraduates), Keck Science Department, Scripps College

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01093530(coding)
ATGGCATCAAGCAAGAAAGTTTTTGAATTCAAAGATGACCTCAATGGTAGCGGAAAAGTG
TTATTTTCATGGAGCTAAGATTGTAGTTATATCGCAGTTTGTGGATAATCGAAGGTGGTT
TATGTGCTTGATAAGAGAGGTAGAAAACTTAAAGAAACTGTTTTAAAATCTAAGAATAAA
GTTATAGGTTTAGAATGGGATAAAGACTAGGAATTTTTGGCAATATTATAGGAAAACTCT
ACATGCTTTTTGCTGTGGAATGTATTCTAAAACAGCTTTGAATAGTAGGATTTAGAAGAA
AAATCAAAAGGAAGTTTTATTAAATGGTCTAAAACTCATCCAGTTCTTGTGATTGGAACT
GAAAAAGGCATTCTTTATTTTTATAATAAAAAAACTCAAAAGAAAATTCCTACTATGGGT
AAGCACTCAAAGAAAATCACTACAGGAGATTGGAACGATGAAGGATTGTTAATTACTGGT
AGTGAAGAAAAAGTATTAACTGTTAGTAGCCATAACAGCGATTCTAAAGGAGAATCTATT
ACAGTTTAGCATGAACCCAGTAATCTTTAATGGGCACGTTAAAAGACAGACGATCGTGAT
AGTTCTTAAAGAACCATTACTGCTATATTAAGCAACAAAAGTATACTTATGTATGATCTA
AACACTAAGAAATAGCCATTAGAACTTGTTTATGAACCAAAATATGGAAAAATTGTTGAT
TATTAACTTTTTGGAGATGGATATATAGTTACTGGTTTTACTGAAGGATATGTTGCACAT
GTCTCTTCTCATTTATATGAATTAAGGGATGAAATTTAGTCTAAGAGAATATTTTAAAGT
TCCCTTGATGCTCTTTGTACAAATGATATCATTTATAAATTGGCAGTTGCTGGAGAAAAT
TAAATTCACATCTACAATCTTGGAACTTGGGAAGAAGTTAAATCTTAAAGAATAGAGCTT
CCTAAAGCAGCAGGTAATGTAACTAAAATGTAATGGGCTAATAATGGGTAATTGCTTGTT
GTTGCTACAGCCAATGGACATTTGTATGGTTATTTAACTAGTATTCCATTCTTAACTAGC
ACCTATGGATCAATCGTTTCAGTCTTATCATCCTTTACTGAAGTTTCTATTGTTGATACA
AGTAGAATCAATCAAATACAAAATGTATCATCTATTAATTTAGAAACTGAACCAGGATTT
TTATCATTAGGTTTATATCACTTGGCAGCAGGTATCAATAACAATGTATGGTACTATTTA
TGGCTAGACCAAAAAAGAAATGGTATAATTAAAGGAGGAGAAATGATACAAAAGAGAGAT
TATTTAGGAAGTGTTAAAGACATCAGACTAAATGAATTTTGGGCAGCAGTGTTAACTGAT
GGCAAGTGCATTCTTCATACAATTCAACCAAATAACAATGTCAAAGATTAGAAATTCCCT
CAAATCGAAACAGATAAAGCTATATCAGGAATTGGTTTAACAAACGACTTCTTGATTATG
CTAGACTCATCTGGTAAGATTAGATATTATCATTTAGAAGATCAACAATTTGTTGTTGAG
TACAAACCTGCTGATTGCTAATTGGTTAAGATTTATCCCAACTTTTCAGGTACAAGAGTT
GTTTGCTTTGACAATAAAGGTTCTGCTTATTTATTTGAACCAGCACAAGAGCAATTTTAT
CCTTTAGAGCATTTCCCTTAGAGAGCTGAAAAAGTTCTATGGGACTAAAAAGACCCTAAC
TTATTTGCTGTCTTGCAAAATGACACTTTAATTACATTCATAATTAATAAAAATAATATA
AATGGTACTCTTATTTAACCTGTTAAAGAACTACTTGCTATTGAAGACATAAAAAATCCT
GGACCTCCTGTTTAAACAATCTTAGACAGAGGAGTCAAACCATTAACATTATCAAATGGA
CTTCTTAAGTGCTTCACACCAAGTGGTAGTATAAACGGCTAGAATTTAACTTCCCATAGT
TACTTAGGGAGTTACAAAGGTAGAGATGACACTGATTAAGGGCACTACAGATTCTTCCTG
TAAAATCTTCAATTGCACAAGTACAATAATTGTTTGATTGCTGCACAATTTCTCCATAAT
GCAGTACTTTACAAAGAGCTTGGACGCAAGGCATTAGAATTTGTTGATCTTGATGTTGCC
TTGAAATCTTATCAACTTGCTGGAAGTTTATCTATGGTTATGACAATATAAAGCTTTTAG
CATATTAATGAAAAAAATATAATATATGGAAACATTGCTATGATTTTAGGTCAGTATGAC
TTGGCTTAAGAGTTATTCTTAAAATCATCCTAGCCTATTTTGGCTCTTGAAATGAGAAGT
GATATACAAGATTACTTGACAGCTCTTAATCTTGCGAAAAGCATAGCACCTTAAGAAGAG
CCATTTATTTGCAGAAGATTAGCTTTCTAAATAGAGAATTAAGGAAATAACTAAGAAGCC
AGAAAATTATATGAAAGAGCTGTTTTAAACAAAGACGATCGTCCTTCAGATAGAAGCAAA
ATCGATAATCATAATTAACTTTGCTTTGCAGGTATTTCTCGTACTTCTATTAAACTTGGA
GATATTCAAAGAGGTGTTACTATAGCTAAAGAACTAATTGACAATAATATTGTTATCGAA
ATAGCAGTAGTTTGTGAGAATATGAAGTAGTATCTTGAAGCTGCTGAACTTTACCAAAAG
TCTGGAATGCTTGAAAAAGCAGCATCTTTATATATTGAATCAAAAGACTTTAAAAAAGCT
GCTCCTTTAATCAGCATGATAAAATCCCCCAATCTTCTTAAGCAATATGCAAAAGCTAAA
GAATCCGAAGGTGCATATAATGAAGCAGAACAAACATATGAATAAGCCGAATCATGGGAA
GATGTTGTTAGATTAAATCTGGATAAATTAGATAACTTAAGAAAAGCAATTGCCGTCTTA
AGGACTAAATGTGATACAAGCACTGTTTGCTTAATGGTTGCTAACGTATGTGAAAAGTAA
GGAAATTATGGTGAATTAGTTGAATTTTTACTCAAAGCTGGAAAAAAAGAAGAGGCCTTT
TAAAAAGCTTAGTAATATAATGTCATGGATGCCTATTCTGATAATATGAAAGATTTCACT
TTAGAAGAGCGTTTGCGTATTGCCTAATATTATGAAAATTAAGGAATTTGGGTTAAGGCT
GCTAAGCATTTCGAATAAGCTAAAAATCCTACTAAATCTTTAAAGCTTTACTTAAAGGCT
GGGGATTAATATATTGATGATATGATTGATCTTGTTTGTAGAAATAAGTAACAAGAATCT
CTTTAACAGACTCTTCTTGATTATTTGCTTGAAGGAGAAAAACCTAAAGATCCTATATAT
CTTCTTAAATTGTATGATAAATTGGGTAACATTTAGTCTTTAGTCAAAATAGCAATTACT
ATTGCTAGCGACGAACATGATTAAGGTAATTACAAAATAGCTCATGAAAGACTCTTCGAA
ACTTATCAAAAAGTAAAAGAACATAATGTTGCTATTCCTTTCGACCTCGAGTAAAAATTA
ATGATTATTCACTCTTATATCTTGGCTAGAAAGTATTTAGCTTACAAAGAAGAAGATAAA
GAAATAGAACTTGCAGCTTGGTTACTTAACAGAGTTTGCAAAAATATAAGTTAATTCCCC
ACTCACGCTGTCAATATTTTAACATCTGCAGTAATTGCAGCTATGAAAAGCAAAAACAGA
CCACTAGCTTACAAGTGGTCAGTTGAATTAGTTCGCCCTGAATACCGTTCACACATAAAT
GAAAAATACAAAACTAGAATTGAAAACATTGCTAGAAAGCCACTAAAAGAAGAGCCTGTG
GAAAACAAAACTGAGTGTCCATTCTGCAAAGAATATGTAGGCGAATTTTAGTTAGTCTGT
GAATCTTGTTAAAACGTCATACCCTTTTGTATTGCTTCAGGAACACACGTTATTGCTGAC
CAGCTTTGTTTCTGCCCATCTTGCAGATTCCCAGCAAATATTAATTATTTTATAAAGTAC
GCTGAATCAGAAGAGGGAAGATGCCCTATGTGTTCAGTTTAAATTAATTTAAATGAAGTA
AAAGTGGAAAATCCAGAACAGGCTGCTTCTATATTAAAATAACTTAGAGCAACAAGATAA
AGTTCTGAGTAAAAGAAAAAATGA


>TTHERM_01093530(protein)
MASSKKVFEFKDDLNGSGKVLFSWSQDCSYIAVCGQSKVVYVLDKRGRKLKETVLKSKNK
VIGLEWDKDQEFLAILQENSTCFLLWNVFQNSFEQQDLEEKSKGSFIKWSKTHPVLVIGT
EKGILYFYNKKTQKKIPTMGKHSKKITTGDWNDEGLLITGSEEKVLTVSSHNSDSKGESI
TVQHEPSNLQWARQKTDDRDSSQRTITAILSNKSILMYDLNTKKQPLELVYEPKYGKIVD
YQLFGDGYIVTGFTEGYVAHVSSHLYELRDEIQSKRIFQSSLDALCTNDIIYKLAVAGEN
QIHIYNLGTWEEVKSQRIELPKAAGNVTKMQWANNGQLLVVATANGHLYGYLTSIPFLTS
TYGSIVSVLSSFTEVSIVDTSRINQIQNVSSINLETEPGFLSLGLYHLAAGINNNVWYYL
WLDQKRNGIIKGGEMIQKRDYLGSVKDIRLNEFWAAVLTDGKCILHTIQPNNNVKDQKFP
QIETDKAISGIGLTNDFLIMLDSSGKIRYYHLEDQQFVVEYKPADCQLVKIYPNFSGTRV
VCFDNKGSAYLFEPAQEQFYPLEHFPQRAEKVLWDQKDPNLFAVLQNDTLITFIINKNNI
NGTLIQPVKELLAIEDIKNPGPPVQTILDRGVKPLTLSNGLLKCFTPSGSINGQNLTSHS
YLGSYKGRDDTDQGHYRFFLQNLQLHKYNNCLIAAQFLHNAVLYKELGRKALEFVDLDVA
LKSYQLAGSLSMVMTIQSFQHINEKNIIYGNIAMILGQYDLAQELFLKSSQPILALEMRS
DIQDYLTALNLAKSIAPQEEPFICRRLAFQIENQGNNQEARKLYERAVLNKDDRPSDRSK
IDNHNQLCFAGISRTSIKLGDIQRGVTIAKELIDNNIVIEIAVVCENMKQYLEAAELYQK
SGMLEKAASLYIESKDFKKAAPLISMIKSPNLLKQYAKAKESEGAYNEAEQTYEQAESWE
DVVRLNLDKLDNLRKAIAVLRTKCDTSTVCLMVANVCEKQGNYGELVEFLLKAGKKEEAF
QKAQQYNVMDAYSDNMKDFTLEERLRIAQYYENQGIWVKAAKHFEQAKNPTKSLKLYLKA
GDQYIDDMIDLVCRNKQQESLQQTLLDYLLEGEKPKDPIYLLKLYDKLGNIQSLVKIAIT
IASDEHDQGNYKIAHERLFETYQKVKEHNVAIPFDLEQKLMIIHSYILARKYLAYKEEDK
EIELAAWLLNRVCKNISQFPTHAVNILTSAVIAAMKSKNRPLAYKWSVELVRPEYRSHIN
EKYKTRIENIARKPLKEEPVENKTECPFCKEYVGEFQLVCESCQNVIPFCIASGTHVIAD
QLCFCPSCRFPANINYFIKYAESEEGRCPMCSVQINLNEVKVENPEQAASILKQLRATRQ
SSEQKKK


>TTHERM_01093530(gene)
ATGGCATCAAGCAAGAAAGTAATACTTGTTAATCTATTTTTTAGCCAAATTTTAATTGGA
AGTGGAGTTAGATTATTGCGAGTTCTAAATCACTTAATCTTTACTTGATAATTATATCTT
TGAGATATTAAATTTAATAAAATTTTATGGCTAAATATGCCTATAATTTAGCATTTGTTT
AGGCCATATGCTTCAATTAGTTTATATAAAATAATCATAGGTTTTTGAATTCAAAGATGA
CCTCAATGGTAGCGGAAAAGTGTTATTTTCATGGAGCTAAGATTGTAGTTATATCGCAGT
TTGTGGATAATCGAAGGTGGTTTATGTGCTTGATAAGTAATTAAACTCAATATAATTAAT
TTTAAGAAGGGCAAAAATTAAATGTTATATAGTTGATATTAAATTTATTTAGAAGTTTGC
TATTCTAATTTTTACAGTTTCTGCAAGCCCAAGTTTTAAAATGCCTAGAAGTTACAAAAT
TATGATTTGTTAATAAAAATTTTAAAATATCATAGGAGAGGTAGAAAACTTAAAGAAACT
GTTTTAAAATCTAAGAATAAAGTTATAGGTTTAGAATGGGATAAAGACTAGGAATTTTTG
GCAATATTATAGGTAAATATAAAGTTATTATATCAATTTTTTAAATTATAAAATTATAAG
AAGCTTAATTTTAAGTACGATTCTACTAAATACAAGCAATTTAAAATTAAAACATTTATT
GATTGATAGATTTTATAATATTAAATCAGTACTAGATAAGAGTTATTATCTATTACTTTA
TATATTTATAAATTCATGCAAATATTAAATAGGAAAACTCTACATGCTTTTTGCTGTGGA
ATGTATTCTAAAACAGCTTTGAATAGTAGGATTTAGAAGAAAAATCAAAAGGAAGTTTTA
TTAAATGGTCTAAAACTCATCCAGTTCTTGTGATTGGAACTGAAAAAGGCATTCTTTATT
TTTATAATAAAAAAACTCAAAAGAAAATTCCTACTATGGGTAAGCACTCAAAGAAAATCA
CTACAGGAGATTGGAACGATGAAGGATTGTTAAGTAAAATTAATTCACTTTTAAAATTAT
GTAGTTTAGGAATTTCAATTTTTTATTTAATAGTTACTGGTAGTGAAGAAAAAGTATTAA
CTGTTAGTAGCCATAACAGCGATTCTAAAGGAGAATCTATTACAGTTTAGCATGAACCCA
GTAATCTTTAATGGGCACGTTAAAAGACAGACGATCGTGATAGTTCTTAAAGAACCATTA
CTGCTATATTAAGCAACAAAAGTATACTTATGTATGATCTAAACACTAAGAAATAGCCAT
TAGAACTTGTTTATGAACCAAAATATGGAAAAATTGTTGATTATTAACTTTTTGGAGATG
GATATATAGTTACTGGTTTTACTGAAGGATATGTTGCACATGTCTCTTCTCATTTATATG
AATTAAGTAAGCAGATTTATTTATCCTTTTTTTTATATTTAATAAATATTTAATCAAAAG
GGGATGAAATTTAGTCTAAGAGAATATTTTAAAGTTCCCTTGATGCTCTTTGTACAAATG
ATATCATTTATAAATTGGCAGTTGCTGGAGAAAATTAAATTCACATCTACAATCTTGGAA
CTTGGGAAGAAGTTAAATCTTAAAGAATAGAGCTTCCTAAAGCAGCAGGTAATGTAACTA
AAATGTAATGGGCTAATAATGGGTAATTGCTTGTTGTTGCTACAGCCAATGGACATTTGT
ATGGTTATTTAACTAGTATTCCATTCTTAACTAGCACCTATGGATCAATCGTTTCAGTCT
TATCATCCTTTACTGAAGTTTCTATTGTTGATACAAGTAGAATCAATCAAATACAAAATG
TATCATCTATTAATTTAGAAACTGAACCAGGATTTTTATCATTAGGTTTATATCACTTGG
CAGCAGGTAAATAAATAACATCATTAAAAGCTGTTTTAAATATAAAAAATTTACATAAAA
ACATGTTTCAAAATAAAAAAAATATCAAAACAAATTTTTAAAAAAGGTATCAATAACAAT
GTATGGTACTATTTATGGCTAGACCAAAAAAGAAATGGTATAATTAAAGGAGGAGAAATG
ATACAAAAGAGAGATTATTTAGGAAGTGTTAAAGACATCAGACTAAATGAATTTTGGGCA
GCAGTGTTAACTGATGGCAAGTGCATTCTTCATACAATTCAACCAAATAACAATGTCAAA
GATTAGTAAATATTTTTCATTAAAATTGCAACTAAAAGTATCTATTTTAAAAAGGAAATT
CCCTCAAATCGAAACAGATAAAGCTATATCAGGAATTGGTTTAACAAACGACTTCTTGAT
TATGCTAGACTCATCTGGTAAGATTAGATATTATCATTTAGAAGATCAACAATTTGTTGT
TGAGTACAAACCTGCTGATTGCTAATTGGTTAAGATTTATCCCAACTTTTCAGGTACAAG
AGTTGTTTGCTTTGACAATAAAGGTTCTGCTTATTTATTTGAACCAGCACAAGAGCAATT
TTATCCTTTAGAGCATTTCCCTTAGAGAGCTGAAAAAGTAATTTCTTATTTTATTTTTTT
GATAGAATGACTAAATACAAATTCTTAATTAGGTTCTATGGGACTAAAAAGACCCTAACT
TATTTGCTGTCTTGCAAAATGACACTTTAATTACATTCATAATTAATAAAAATAATATAA
ATGGTACTCTTATTTAACCTGTTAAAGAACTACTTGCTATTGAAGGTAATTAATTCTTTT
CTTAGAATTTTTAAAAAATATCTTATTAAATAAAATTCAAAGACATAAAAAATCCTGGAC
CTCCTGTTTAAACAATCTTAGACAGAGGAGTCAAACCATTAACATTATCAAATGGACTTC
TTAAGTGCTTCACACCAAGTGGTAGTATAAACGGCTAGAATTTAACTTCCCATAGTTACT
TAGGGAGTTACAAAGGTAGAGATGACACTGATTAAGGGCACTACAGATTCTTCCTGTAAA
ATCTTCAATTGCACAAGTACAATAATTGTTTGATTGCTGCACAATTTCTCCATAATGCAG
TACTTTACAAAGAGCTTGGACGCAAGGCATTAGAATTTGTTGATCTTGATGTTGCCTTGA
AATCTTATCAACTTGCTGGAAGTTTATCTATGGTAATTTAACTAAATTTAAAATTGTTGG
TCTAAGGATTTATTAATTAATATTAGGTTATGACAATATAAAGCTTTTAGCATATTAATG
AAAAAAATATAATATATGGAAACATTGCTATGATTTTAGGTCAGTATGACTTGGCTTAAG
AGTTATTCTTAAAATCATCCTAGCCTATTTTGGCTCTTGAAATGAGAAGTGATATACAAG
ATTACTTGACAGCTCTTAATCTTGCGAAAAGCATAGCACCTTAAGAAGAGCCATTTATTT
GCAGAAGATTAGCTTTCTAAATAGAGGTAAAATATAAATAAAAATTATGATATGAATAAA
AATAATAAAAATAATAGAATTAAGGAAATAACTAAGAAGCCAGAAAATTATATGAAAGAG
CTGTTTTAAACAAAGACGATCGTCCTTCAGATAGAAGCAAAATCGATAATCATAATTAAC
TTTGCTTTGCAGGTATTTCTCGTACTTCTATTAAACTTGGAGATATTCAAAGAGGTGTTA
CTATAGCTAAAGAACTAATTGACAATAATGTAACTTATTTACAAAGTGATCATAATAGCT
TATTTCTATTATATATTTTAGATTGTTATCGAAATAGCAGTAGTTTGTGAGAATATGAAG
TAGTATCTTGAAGCTGCTGAACTTTACCAAAAGTCTGGAATGCTTGAAAAAGCAGCATCT
TTATATATTGAATCAAAAGACTTTAAAAAAGCTGCTCCTTTAATCAGCATGATAAAATCC
CCCAATCTTCTTAAGCAATATGCAAAAGCTAAAGAATCCGAAGGTGCATATAATGAAGCA
GAACAAACATATGAATAAGCCGAATCATGGGAAGGTAAAATTAAATTTTGAAAATAATTT
TAACATATGTTATCAATATTAATTAATAATTAATTTTATAGATGTTGTTAGATTAAATCT
GGATAAATTAGATAACTTAAGAAAAGCAATTGCCGTCTTAAGGACTAAAGTAAATTTAAT
ATTTCTTTCATAAATAAAAATAAATAAATTTGTTTTATTTAATAGTGTGATACAAGCACT
GTTTGCTTAATGGTTGCTAACGTATGTGAAAAGTAAGGAAATTATGTAAAAATATTTATT
CATATGTAGAATAGCGTTATCTAATTATACATTTTCATAAAAAAAGGGTGAATTAGTTGA
ATTTTTACTCAAAGCTGGAAAAAAAGAAGAGGCCTTTTAAAAAGCTTAGTAATATAATGT
CATGGATGCCTATTCTGATAATATGAAAGATTTCACTTTAGAAGAGCGTTTGCGTATTGC
CTAATATTATGAAAATTAAGGGTATTAAAATTTAAATTTTTGAAAAATTTGTTAGATATC
TTTTTAAACTATTTAATTAGAATTTGGGTTAAGGCTGCTAAGCATTTCGAATAAGCTAAA
AATCCTACTAAATCTTTAAAGCTTTACTTAAAGGCTGGGGATTAATATATTGATGATATG
ATTGATCTTGTTTGTAGAAATAAGTAACAAGAATCTCTTTAACAGACTCTTCTTGATTAT
TTGCTTGAAGGAGAAAAACCTAAAGATCCTATATATCTTCTTAAATTGTATGATAAATTG
GGTAATTGAAAATTTAATTTAAGCAAACAAAATAAAGAATAATTCATTAAAAAACAAATA
AGGTAACATTTAGTCTTTAGTCAAAATAGCAATTACTATTGCTAGCGACGAACATGATTA
AGGTAATTACAAAATAGCTCATGAAAGACTCTTCGAAACTTATCAAAAAGTAAAAGAACA
TAATGTTGCTATTCCTTTCGACCTCGAGTAAAAATTAATGATTATTCACTCTTATATCTT
GGCTAGAAAGTATTTAGCTTACAAAGAAGAAGATAAAGAAATAGAACTTGCAGGTAATTA
ATTGATTTTTTGTTTTCAAATAATTGAGAAAAAAATATTGTATTTAAATGTTGTTATATT
TTTTATGATCCTGTCTATTTCATTAATATTAATAATAAAAAAGCTTGGTTACTTAACAGA
GTTTGCAAAAATATAAGTTAATTCCCCACTCACGCTGTCAATATTTTAACATCTGCAGTA
ATTGCAGCTATGAAAAGCAAAAACAGACCACTAGCTTACAAGTGGTCAGTTGAATTAGTT
CGCCCTGAATACCGTTCACACATAAATGAAAAATACAAAACTAGAATTGAAAACATTGCT
AGAAAGCCACTAAAAGAAGAGCCTGTGGAAAACAAAACTGAGTGTCCATTCTGCAAAGTA
AAATAAAAATAATAAGCTTTATATAATTTATTATTTTTTTTAGGAATATGTAGGCGAATT
TTAGTTAGTCTGTGAATCTTGTTAAAACGTCATACCCTTTTGTATTGCTTCAGGAACGTA
AATAATTTAAACTTAAATTTTGATTTATTTTTAAAACAAATCTTTTAAATGTTATAGACA
CGTTATTGCTGACCAGCTTTGTTTCTGCCCATCTTGCAGATTCCCAGCAAATATTAATTA
TTTTATAAAGTACGCTGAATCAGAAGAGGGAAGATGCCCTATGTGTTCAGTTTAAATTAA
TTTAAATGAAGTAAAAGTGGTAAGAATTTAAATAATTTATTAATTTAAAAATAATAATGT
CATAAAATAACGTAAAAACAGGAAAATCCAGAACAGGCTGCTTCTATATTAAAATAACTT
AGAGCAACAAGATAAAGTTCTGAGTAAAAGAAAAAATGA