Identifiers and Description

Gene Model Identifier

TTHERM_01016030

Standard Name

MAC1

Aliases

PreTt02637 | 198.m00057 | 3746.m00321

Description

Appr-1-p processing enzyme family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.9%

TetraMine Data

TTHERM_01016030

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20179.11.0001689416974253e-96appr-1-p processing enzyme fam
ily protein (310 aa)
OxytrichaContig12236.0.g751.999534248571833e-46Macro domain
Stentor CoeruleusSteCoe_148042.6102790696677047e-23
DictyBaseDDB_G02782299.998720540547892e-23DDB_G0278229 on chromosome: 3
position 512537 to 515209
WormBaseWBGene000071064.998394530072393e-19status:Confirmed UniProt:Q17
432 protein_id:CAA97408.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:23884606: Gao S, Xiong J, Zhang C, Berquist BR, Yang R, Zhao M, Molascon AJ, Kwiatkowski SY, Yuan D, Qin Z, Wen J, Kapler GM, Andrews PC, Miao W, Liu Y (2013) Impaired replication elongation in Tetrahymena mutants deficient in histone H3 Lys 27 monomethylation. Genes & development 27(15):1662-79

Sequences

>TTHERM_01016030(coding)
ATGAATAATATTTTTAGTAAAATATAAAAATTGCCAAAAATGATGAATTTATTTTAACTT
AAAAGTTATTTTAAAACTACCTAAAAACCTACTTATACTATTGGAAACTTATCTTCATAA
CCGATTTTGTAATAAAAGATTGGGGAAACTTAGATATCTATTGTTAAAAATGATCTAACA
ATGGAAAATGTTGATGCGATTGTAAACGCTGCTAATAACTTTTTAGCACATGGAGGAGGA
GTTGCAGGAGCAATTTGCAGAAAGGGAGGAAGAATTATACAAAATTAGAGTTATGACATA
ATAAAAATAAGAAATAGAATTGAAAATGGAGAATCAGTCACTACTGAAGCTGGACAACTT
CCTTGTAAAAAAGTTATTCATACAGTAGGACCTATTTGGGAAGATGGAGACAGTAATGAA
AAAGAAGAGCTAGCTAAATGTATGGAAACAATTTTAAGAGAGGCTAAATTTTATAAATTA
AAATCTATATCTATACCAGCCATATCTTCTGGTATATTTGGATTCCCTAAATATTTGTGC
GCCAAAATTTTGCTAGAAGAAACTTAAAAGCTATTGAAGTATGATTACTCTAATTAATTT
GAAGAAATAAGATTCTGCAACTTTGATAACGAAACAGTTTAGGTATTTGCTGAAGAGTTT
TAAAAGCAATTTTAGAATAAAGAACCCTAGTAGATTGAATAGCAAAGCAAAAAAAAAAAA
GAAAATAATTAAAATGAAGGCCTAAACGAAGATTTTTAGGAAGAACAGAAAGATAATTTG
AAAAACTTAGAGAAACCAAAAATCTAAGACCAAGATCTTTCGAATAATAAGGAAAAGCAA
GCTTAGAAATCATAGGAAGAAAATGAAATTAAGAAATAAGAAATAAAAGAATACAAAGAT
AAACATAGTGAAATTTAAAAGGAACAAAAAAATGAAAACCTTGAAAAATTATCAAAACAA
AAAGAGTGGATTATTAAAGATGCTAAAAATAATATCTCATAAAACCCTAGCTATGTTAAA
TAAAATGAAGGAGATCAAGCAATAGATGCTTAATCTTAGTAGTCCTCATAAGTAAAAGGC
CAATAGAATAAGGTACAAATACTATACAAAAAAATTTGA


>TTHERM_01016030(protein)
MNNIFSKIQKLPKMMNLFQLKSYFKTTQKPTYTIGNLSSQPILQQKIGETQISIVKNDLT
MENVDAIVNAANNFLAHGGGVAGAICRKGGRIIQNQSYDIIKIRNRIENGESVTTEAGQL
PCKKVIHTVGPIWEDGDSNEKEELAKCMETILREAKFYKLKSISIPAISSGIFGFPKYLC
AKILLEETQKLLKYDYSNQFEEIRFCNFDNETVQVFAEEFQKQFQNKEPQQIEQQSKKKK
ENNQNEGLNEDFQEEQKDNLKNLEKPKIQDQDLSNNKEKQAQKSQEENEIKKQEIKEYKD
KHSEIQKEQKNENLEKLSKQKEWIIKDAKNNISQNPSYVKQNEGDQAIDAQSQQSSQVKG
QQNKVQILYKKI


>TTHERM_01016030(gene)
ATGAATAATATTTTTAGTAAAATATAAAAATTGCCAAAAATGATGAATTTATTTTAACTT
AAAAGTTATTTTAAAACTACCTAAAAACCTACTTATACTATTGGAAACTTATCTTCATAA
CCGATTTTGTAATAAAAGATTGGGGAAACTTAGATATCTATTGTTAAAAATGATCTAACA
ATGGAAAATGTTGATGCGATTGGTATTTAAAATATATGAAACATGATTCAGAATTAAATG
ATTTAATTAAAATATAAATAAAGTAAACGCTGCTAATAACTTTTTAGCACATGGAGGAGG
AGTTGCAGGAGCAATTTGCAGAAAGGGAGGAAGGTAATTAATTAAATAACAATACTTTTT
AAAAACCCTAAGTTCATTTCTAAATAATTAATAAATAGAATTATACAAAATTAGAGTTAT
GACATAATAAAAATAAGAAATAGAAGTAATTTGAAATTTATTGAATATCTAATTTATTTA
ACTTACTTAATGTACTAATACTAAAATTTAATTTACAAGTTGAAAATGGAGAATCAGTCA
CTACTGAAGCTGGACAACTTCCTTGTAAAAAAGTTATTCATACAGTAGGACCTATTTGGG
AAGATGTATTTAATAAATTTTGAAGTAATTTTACAAATGGATTATTTTTAAAAATTAAGG
GAGACAGTAATGAAAAAGAAGAGCTAGCTAAATGTATGGAAACAATGTAAATAAATGTAC
TTCTAATTTAATTATATTTAAATATTTATTTTTGTAACAAAAGTTTAAGAGAGGCTAAAT
TTTATAAATTAAAATCTATATCTATACCAGCCATATCTTCTGGTATATTTGGATTCCCTA
AATATTTGTGCGCCAAAATTTTGCTAGAAGAAACTTAAAAGTATTATAGATATTCAATTC
ATTTTTTTATAGCTTTTAATTAATTATTTGTCAAATAGGCTATTGAAGTATGATTACTCT
AATTAATTTGAAGAAATAAGATTCTGCAACTTTGATAACGAAACAGTATAAGATTTTAGT
ATATCAATATGACTGATTTTAAATAAATAATAAGGTTTAGGTATTTGCTGAAGAGTTTTA
AAAGCAATTTTAGAATAAAGAACCCTAGTAGATTGAATAGCAAAGCAAAAAAAAAAAAGA
AAATAATTAAAATGAAGGCCTAAACGAAGATTTTTAGGAAGAACAGAAAGATAATTTGAA
AAACTTAGAGAAACCAAAAATCTAAGACCAAGATCTTTCGAATAATAAGGAAAAGCAAGC
TTAGAAATCATAGGAAGAAAATGAAATTAAGAAATAAGAAATAAAAGAATACAAAGATAA
ACATAGTGAAATTTAAAAGGAACAAAAAAATGAAAACCTTGAAAAATTATCAAAAGTAAG
AAATATAAATTTTCTATTTAATTTTAATAGAGTTTTTTTTAGAGTAAAAATTATTTTTTT
CAATTTTATTATTTGTTTTCTTAACAACTTTAAGAAGCATTAAGAAAGTTTAACTATATT
TTAACATAATTTTATTTTATAATTATTAAGCAAAAAGAGTGGATTATTAAAGATGCTAAA
AATAATATCTCATAAAACCCTAGCTATGTTAAATAAAATGAAGGAGATCAAGCAATAGAT
GCTTAATCTTAGTAGTCCTCATAAGTAAAAGGCCAATAGAATAAGGTACAAATACTATAC
AAAAAAATTTGA