Identifiers and Description

Gene Model Identifier

TTHERM_00591560

Standard Name

Lin9

Aliases

PreTt24171 | 81.m00228 | 3726.m00104

Description

DIRP family protein. Ortholog of human Lin9 protein. Subunit of Tetrahymena MuvB complex. Other putative MuvB subunits include RebL1, Anqa1, Jinn1 and Jinn2.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00591560

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16999.19.997093137033517e-262hypothetical protein (792 aa)
OxytrichaContig22653.0.g271.999981404597394e-31DIRP
Stentor CoeruleusSteCoe_124960.000000000000012664165549094176
DictyBaseDDB_G02866650.00000000002000577768187062lin9 on chromosome: 4 position
4807662 to 4811421
WormBaseWBGene000029980.00000005001214305021125locus:lin-9 Protein lin-9
status:Confirmed UniProt:P30
630 protein_id:CAA77454.2

General Information

Paragraph NoGene NameParagraph Text
146Lin9Affinity purification followed by mass spectrometry analysis indicated that Lin9 interacts with Anqa1, RebL1, Jinn1 and Jinn2 proteins (Nabeel-Shah et al. 2021).

Associated Literature

  1. Ref:34086947: Nabeel-Shah S, Garg J, Saettone A, Ashraf K, Lee H, Wahab S, Ahmed N, Fine J, Derynck J, Pu S, Ponce M, Marcon E, Zhang Z, Greenblatt JF, Pearlman RE, Lambert JP, Fillingham J (2021) Functional characterization of RebL1 highlights the evolutionary conservation of oncogenic activities of the RBBP4/7 orthologue in Tetrahymena thermophila. Nucleic acids research ( ):

Sequences

>TTHERM_00591560(coding)
ATGACTGATTACAAGAAAATCATATAAGATCTCGACAAAACAAAAAAGTTTGACATGGGT
CCCAGATGGAAACCTGAAGAGCTAGACATATTTTTGAAATATTACAGGGAATCTGAGTTT
GACAAACTCGATGAAATGCAGCAAGTCCTTTCATAAAATGGATACGAGCGCTCTAAAATA
AATCTAATCAGCGTTTATCTCAAGAATAAGAATTTCTTGAACTTTAACAAATAAGTTACA
GGGGATATGCTTGCTATGATTATGGCTGACCATTATGATAACTTAGAAATATAATAATAG
CAGTTAATCAATTAGAAAGAAGAAGCCAAAAAAAGATAGAAGTAGCAATTATTGCAATAG
CAGTAGCAAAATGTAGTACCATCTCTATCTAGTTAGATTGAGGCATTAAACAATTAGCAA
AAGTCTCTCAACTAGGCTAATTTGCCTTCAAGCAATGAAGATATCAATAGCAAAAAGGCA
GCTTCTACTGCTATCAATCCACCTTAAAGCAACAGAAAAAAGTAAAAAATTTAAAAAGGA
TTGAATGAATAAAGTGAAAACATGAATAATGGATCCATGCTATAAATGATGCAGCTTTTA
AACCAAGGAAATAATTCTCAATTTAACTCTTAAGCGTAGTAAGTGTTAGGTCTAAATAAT
GGAAACAACGTTTCAAATAGTAACATCACAACATTTTAGCATGTTAATAAAAGAAAGTCA
AAAATGCCAAAAGGAAGATTTCTTTTTGATTTGCCAAATGATTTTGAAAAAAGAATAGCA
TACATTGAAGAAATATCAAAGAATTGCAATGGAAAAAACCCTAAAAAGCAAACAAAGAAA
TTGTCTTCTTAAGAGTAAATAAACGAAAGAAGTTTACAATGGATAGAACATGAATTCTTT
TACAGCACAATAGATAAACCTTTCTTCTAGTTCAATGAGTTCAAAGAGATGCTAGCTAAG
GTTGGACTTGAAAACATTGGTAAATTAACCAGAGCAGAGTGGAATATAATCAGAAAAGCT
ATGGGAAAGCCAAGAAGATTTTCTAATGAATTCGTTAGAGGAGAATTAAAAAAGCTGGAA
ATTTACAGAAAAATTGTTCGTGAATACCTCTAAACTTAATAAGCACATGTCCTCAGAAGC
AAAATCAGGGAAAGCCTATCAGAAGAAATTATGAGAATTTAACCGTTTAAGGTAGGTTAA
ATTGTCATGGGTATCCATCCAAATTGCAAGCATTTTCATCCTGGTTCTGTTCTTACTACA
AATGGAGACATGGTGATCTTAAAATTCCTGACTAATGATTTAGGAGTATTGAAAATACCA
GACACTAAATTATCGATAGATTACACTGCTAATATTTAAGGCAACTCAGATGAATTTGCT
AGTTAAAAAGGAAGAGTTATCTTAGACGGATAAGTTGATGAAGGAAATTACAATAAAGCA
TTCTCTAATAATGCCTCTTACTAAAATCAAAATGAATAAAAGCACAGTTCTTAATAAACT
ATTTTGCAAGATTTAGATTATTTTTCGATGGCCTTCTTAATTAAATTGCTTGATAGAAAG
ACTCTTTTAATTAATGAGCTGAAGGAATTTAACGAATTTGCAATTAGAAAAAAAAATGAA
CCTCTTGATGAAACTTTTTACTAAAAATACGGCTGGACTGGTATTCAAATAAACTTGATA
GACAACGCCTTAAAACATGTGATTGCAAAATTTAGATTAAGAGGACTCAACCATTACAGT
TAATAACAAATAGCTGAAAACTTAAATAAAATATTATAAGTACCATTAAGTTATATTGAA
AGAGAGCTTGAAGAAAACCCTGTTGATCAAGGAATACTAAACGAAATCAGAAATATTTCT
AACAAAAATGCAGATGAGAAAATTCAACAGAGTGTAAACTCGATGATAACTAAAGGAGAG
TAAAAGCTTATGAAAGAGAGAGGAGAAGTATATAGAAAGTAGCTAGAAGAAAATTACTAT
TCAAACGGTTATGGAAACCTCTTAAACATTGTTTATAATTGTTTGGGAATACTCCAGACA
TTAAAGTGCACTGGAGATATTAACATAAACCAAAACTAGTTTTTAAATAGTCTCGCTTAG
AGTATATATACCGAAAACTCTGAGCAATTCCTTGAGATAAATGATGTTATTTAAGACATC
CTCTAAAAATATAAAGACTCTAAACGAGAAAACCATTCTTTGCTGAGCAATAGCAATAAT
AATTAAGAACATATTATTTCTTCTTCTTAAAAGTAGTCGCTGAGCAAAGCCAATAATAAT
AATAATTCTAATAATAACAATAATAATGTAAATAATCACCAAGAATTTAATTCTAATTTA
AGCAGCAATCCTCCTTTATGA


>TTHERM_00591560(protein)
MTDYKKIIQDLDKTKKFDMGPRWKPEELDIFLKYYRESEFDKLDEMQQVLSQNGYERSKI
NLISVYLKNKNFLNFNKQVTGDMLAMIMADHYDNLEIQQQQLINQKEEAKKRQKQQLLQQ
QQQNVVPSLSSQIEALNNQQKSLNQANLPSSNEDINSKKAASTAINPPQSNRKKQKIQKG
LNEQSENMNNGSMLQMMQLLNQGNNSQFNSQAQQVLGLNNGNNVSNSNITTFQHVNKRKS
KMPKGRFLFDLPNDFEKRIAYIEEISKNCNGKNPKKQTKKLSSQEQINERSLQWIEHEFF
YSTIDKPFFQFNEFKEMLAKVGLENIGKLTRAEWNIIRKAMGKPRRFSNEFVRGELKKLE
IYRKIVREYLQTQQAHVLRSKIRESLSEEIMRIQPFKVGQIVMGIHPNCKHFHPGSVLTT
NGDMVILKFLTNDLGVLKIPDTKLSIDYTANIQGNSDEFASQKGRVILDGQVDEGNYNKA
FSNNASYQNQNEQKHSSQQTILQDLDYFSMAFLIKLLDRKTLLINELKEFNEFAIRKKNE
PLDETFYQKYGWTGIQINLIDNALKHVIAKFRLRGLNHYSQQQIAENLNKILQVPLSYIE
RELEENPVDQGILNEIRNISNKNADEKIQQSVNSMITKGEQKLMKERGEVYRKQLEENYY
SNGYGNLLNIVYNCLGILQTLKCTGDININQNQFLNSLAQSIYTENSEQFLEINDVIQDI
LQKYKDSKRENHSLLSNSNNNQEHIISSSQKQSLSKANNNNNSNNNNNNVNNHQEFNSNL
SSNPPL


>TTHERM_00591560(gene)
ATGACTGATTACAAGAAAATCATATAAGATCTCGACAAAACAAGTAAATTAATATATTTT
TAAACATCAAGGCAAGCAGCTACATTTTACAAGCCGTATTTTACCTTTCAAAACATAAAA
TATTTTATAATTAAATGCAGAAAAGTTTGACATGGGTCCCAGATGGAAACCTGAAGAGCT
AGACATATTTTTGAAATGTAATTAATTCATTTTTTGTTTATCAAAATTTTTTTTTTTGCT
GTATTTTTATAGCTTGAGTTCTATTTACTGCCAAAAACCCTTAAAATAATAAGTATTAAG
AAAGAAAAAAATCCTAAACAAAAATTAATTGCGCTTATTGCAGTTAGCGATTTCTAATCT
TAATTTTTCTAAATAACTTTTAAATAAAATATGAATCAGATTACAGGGAATCTGAGTTTG
ACAAACTCGATGAAATGCAGCAAGTCCTTTCATAAAATGGATACGAGCGCTCTAAAATAA
ATCTAATCAGCGTTTATCTCAAGGTAAAATGAAGTCAGATTTAAAGATTGAATCTGAATT
TATACTTTTTTTATTTATTTTTATTGTTCCCTCCAAATTTATTGCATAAAGACTTGTTTA
ATTTATTTTAATACTAGCTTTTATATTAATTAATCAATGAATGAATGATTTTAAAAATAG
AATAAGAATTTCTTGAACTTTAACAAATAAGTTACAGGGGATATGCTTGCTATGATTATG
GCTGACCATTATGATAACTTAGAAATATAATAATAGCAGTTAATCAATTAGAAAGAAGAA
GCCAAAAAAAGATAGAAGTAGCAATTATTGCAATAGCAGTAGCAAAATGTAGTACCATCT
CTATCTAGTTAGATTGAGGCATTAAACAATTAGCAAAAGTCTCTCAACTAGGCTAATTTG
CCTTCAAGCAATGTAAAAGCATAGTTTATAAAGTTTTCATTTGCTGAAATTAGTGGAAGT
GATGAAATTTTAATATTTTTCAAATTTAAATTAGGAAGATATCAATAGCAAAAAGGCAGC
TTCTACTGCTATCAATCCACCTTAAAGCAACAGAAAAAAGTAAAAAATTTAAAAAGGATT
GAATGAATAAAGTGAAAACATGAATAATGGATCCATGCTATAAATGATGCAGCTTTTAAA
CCAAGGAAATAATTCTCAATTTAACTCTTAAGCGTAGTAAGTGTTAGGTCTAAATAATGG
AAACAACGTTTCAAATAGTAACATCACAACATTTTAGCATGTTAATAAAAGAAAGTCAAA
AATGCCAAAAGGAAGATTTCTTTTTGATTTGCCAAATGATTTTGAAAAAAGAATAGCATA
CATTGAAGAAATATCAAAGAATTGCAATGGAAAAAACCCTAAAAAGCAAACAAAGAAATT
GTCTTCTTAAGAGTAAATAAACGAAAGAGTATTTATTTATTTATTAATTTTTTTAAATAT
TCAATTTTTGATAATGTCAAATTGAAATATAAAAATAAACTTTTTATTTAGAGTTTACAA
TGGATAGAACATGAATTCTTTTACAGCACAATAGATAAACCTTTCTTCTAGTTCAATGAG
TTCAAAGAGATGCTAGCTAAGGTTGGACTTGAAAACATTGGTAAATTAACCAGAGCAGAG
TGGAATATAATCAGAAAAGCTATGGGAAAGCCAAGAAGATTTTCTAATGAATTCGTTAGA
GGAGAATTAAAAAAGCTGGAAATTTACAGAAAAATTGTTCGTGAATACCTCTAAACTTAA
GTAAATAAATTATTCTCTTTTCTATGTATTTTTAAGCATGGATATATACCATTTTTTAAA
TATATTTAATTGGTATTTATTTAGTAAGCACATGTCCTCAGAAGCAAAATCAGGGAAAGC
CTATCAGAAGAAATTATGAGAATTTAACCGTTTAAGGTAGGTTAAATTGTCATGGGTATC
CATCCAAATTGCAAGCATTTTCATCCTGGTTCTGTTCTTACTACAAATGGAGACATGGTG
ATCTTAAAATTCCTGACTAATGATTTAGGAGTATTGAAAATACCAGACACTAAATTATCG
ATGTAATTTAATAAAAAAGAAATTTAACTAATTTATTTTTGTAATACAGAGATTACACTG
CTAATATTTAAGGCAACTCAGATGAATTTGCTAGTTAAAAAGGAAGAGTTATCTTAGACG
GATAAGTTGATGAAGGAAATTACAATAAAGCATTCTCTAATAATGCCTCTTACTAAAATC
AAAATGAATAAAAGCACAGTTCTTAATAAACTATTTTGCAAGATTTAGATTATTTTTCGA
TGGCCTTCTTAATTAAATTGCTTGATAGGTAAAAAAAATAAATATAAGCAATTTATAATT
AATTTTTATTCTGTTTTAATATAAATGCAGAAAGACTCTTTTAATTAATGAGCTGAAGGA
ATTTAACGAATTTGCAATTAGAAAAAAAAATGAACCTCTTGATGAAACTTTTTACTAAAA
ATACGGCTGGACTGGTATTCAAATAAACTTGATAGACAACGCCTTAAAACATGTGATTGC
AAAATTTAGATTAAGAGGACTCAACCATTACAGTAAAGAATCAGAAATAATAAATTAAAA
AATCATATATGTTATTTTAATTAAATATAGGTTAATAACAAATAGCTGAAAACTTAAATA
AAATATTATAAGTACCATTAAGTTATATTGAAAGAGAGCTTGAAGAAAACCCTGTTGATC
AAGGAATACTAAACGAAATCAGAAATATTTCTAACAAAAATGCAGATGTAATCGATTAAA
CCAAAAATCAACTCTGAATAAAATTATAAACTAACTAGTCATTTTTATAAATATACAATT
AAATTCTATTATCTGTAAATATAAAAAGGAGAAAATTCAACAGAGTGTAAACTCGATGAT
AACTAAAGGAGAGTAAAAGCTTATGAAAGAGAGAGGAGAAGTATATAGAAAGTAGCTAGA
AGAAAATTACTATTCAAACGGTTATGGAAACCTCTTAAACATTGTTTATAATTGTTTGGG
AATACTCCAGACATTAAAGTGCACTGGAGATATTAACATAAACCAAAACTAGTTTTTAAA
TAGTCTCGCTTAGAGTATATATACCGAAAACTCTGAGCAATTCCTTGAGATAAATGATGT
TATTTAAGACATCCTCTAAAAATATAAAGACTCTAAACGAGAAAACCATTCTTTGCTGAG
CAATAGCAATAATAATTAAGAACATATTATTTCTTCTTCTTAAAAGTAGTCGCTGAGCAA
AGCCAATAATAATAATAATTCTAATAATAACAATAATAATGTAAATAATCACCAAGAATT
TAATTCTAATTTAAGCAGCAATCCTCCTTTATGA