Identifiers and Description

Gene Model Identifier

TTHERM_00499370

Standard Name

LTL1 (Lia3-like 1)

Aliases

PreTt07980 | 63.m00158 | 3716.m00012

Description

A Lia3-like protein that regulates DNA elimination boundaries

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF07453 ) NUMOD1 domain
  • ( PF00376 ) transcriptional regulator, MerR family
  • ( TIGR01764 ) DNA binding domain, excisionase family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.8%

TetraMine Data

TTHERM_00499370

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09696.19.997093137033517e-262hypothetical protein (412 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:26950070: Carle CM, Zaher HS, Chalker DL (2016) A Parallel G Quadruplex-Binding Protein Regulates the Boundaries of DNA Elimination Events of Tetrahymena thermophila. PLoS genetics 12(3):e1005842
  2. Ref:26688337: Kataoka K, Mochizuki K (2015) Phosphorylation of an HP1-like Protein Regulates Heterochromatin Body Assembly for DNA Elimination. Developmental cell 35(6):775-88

Sequences

>TTHERM_00499370(coding)
ATGAATTTAACTTCTTAGCCTATAAACATAGAGGCAAAAAGTCTCATAGTCTCATTAAAG
TAAAGGGAATATACTAATGAAGAGATAAATACTATTCTTATCTAACTCGGATATGAGTCG
ACACCAAGAATAGTCTAGAATTAATGGAGAATTTATGAAGAAAGAAAGTAATCTAAGTAA
AAAAAAGAAACAAAGAGAGCTCCTCCTTTTATGCTTAACTCTGAAAAAATAAAGCAAATG
ACCTATCTTTTCCTTAATAATTAAGAAATGACAGTAAATAAGGCGTCGAAATTATTTGGA
ATAGGCAAGTAACAAATTAGGAGATATTTAATTTAGTTTGGTATTGGCTGTACGAAGGGC
AAAGGATAAAAATTTGAAAGATACACTTTTAAAAAATTTAACAAAAAGAAATTGACTTCT
TCTGAAATTGAAGAAATAGAAAACGAAGAGTTATAAAAGCGATTAAATCGTCCTATGATT
CAAGAACCAAGTCCGATAGACCCTTAATCGCCTCCCATTTGGAAAAAGATTGAAATGAGA
ATTATTTTCCCTAAAATAAGATATGGCTAAGTTCATTAGTGGGAAAGATATTATGATAGG
CTAATTAATGAAGTTAAACTAAATAGTTTGAAATTTCTAGATTTTAAAAGGGGAGAAAAA
TTTACTGGTAAAGGCTGCTATATTTACATTTTGTCTGAATATGATTAAAATGTTTTCTTG
GATAATTTTACTTTAGAAAAGTTCTTAGAAACTTCTTTACCAGAGGATTTTTTTGCTGGG
AATTGCCTTAATACAAATAAAATTAGAATTTTTGATTACCCATATATTCCATAAAATTTA
CCTCAGGAGGATATCATTAACCTTAATGATCCAAATATAGAAGAAATATTTAAAAAAGTT
AATAATAAAATCAAAAACATGAATGAATAAGAATAACAACAATTAAACAGTTTAGCACTA
TAAATTCATTAATAATATTAAAAAGATGCAAATAAGTAATTTAATCCAATGAATAGCGAA
TCTTCAATGAGCGAAGAGGAGCCTGATTAAGAATCTAAAAATATTTTATAAATGAATTTA
CAAAAGAAAATTGCAAAAAGCAAATTCTTGCCTAATGTTTAAGGAATGGATATTGATGAA
TAAAATTAGCTATTGTTTAAAGAAATGGATTAGTTAGAAAATAATTAAGATTATTAACTA
GACAACACTCAAGATAACTAATTTTTTGCAAAATAAGAAGACGTTTTAAATTGA


>TTHERM_00499370(protein)
MNLTSQPINIEAKSLIVSLKQREYTNEEINTILIQLGYESTPRIVQNQWRIYEERKQSKQ
KKETKRAPPFMLNSEKIKQMTYLFLNNQEMTVNKASKLFGIGKQQIRRYLIQFGIGCTKG
KGQKFERYTFKKFNKKKLTSSEIEEIENEELQKRLNRPMIQEPSPIDPQSPPIWKKIEMR
IIFPKIRYGQVHQWERYYDRLINEVKLNSLKFLDFKRGEKFTGKGCYIYILSEYDQNVFL
DNFTLEKFLETSLPEDFFAGNCLNTNKIRIFDYPYIPQNLPQEDIINLNDPNIEEIFKKV
NNKIKNMNEQEQQQLNSLALQIHQQYQKDANKQFNPMNSESSMSEEEPDQESKNILQMNL
QKKIAKSKFLPNVQGMDIDEQNQLLFKEMDQLENNQDYQLDNTQDNQFFAKQEDVLN


>TTHERM_00499370(gene)
ATGAATTTAACTTCTTAGCCTATAAACATAGAGGCAAAAAGTCTCATAGTCTCATTAAAG
TAAAGGGAATATACTAATGAAGAGATAAATACTATTCTTATCTAACTCGGATATGAGTCG
ACACCAAGAATAGTCTAGAATTAATGGAGAATTTATGAAGAAAGAAAGTAATCTAAGTAA
AAAAAAGAAACAAAGAGAGCTCCTCCTTTTATGCTTAACTCTGAAAAAATAAAGCAAATG
ACCTATCTTTTCCTTAATAATTAAGAAATGACAGTAAATAAGGCGTCGAAATTATTTGGA
ATAGGCAAGTAACAAATTAGGAGATATTTAATTTAGTTTGGTATTGGCTGTACGAAGGTA
TTTATTTATCGATCAACATAAAAATTTAATAACTTTAATATAATTATTGATTTTATTGTT
AAAGCTATTTTATTAATTATTAAAAGGGCAAAGGATAAAAATTTGAAAGATACACTTTTA
AAAAATTTAACAAAAAGAAATTGACTTCTTCTGAAATTGAAGAAATAGAAAACGAAGAGT
TATAAAAGCGATTAAATCGTCCTATGATTCAAGAACCAAGTCCGATAGACCCTTAATCGC
CTCCCATTTGGTAATTTTTTATATTTGAAAATTTCAGGTAATTTATAGTAAACAAAATCA
TAGGAAAAAGATTGAAATGAGAATTATTTTCCCTAAAATAAGATATGGCTAAGTTCATTA
GTGGGAAAGATATTATGATAGGCTAATTAATGAAGTTAAACTAAATAGTTTGAAATTTCT
AGATTTTAAAAGGGGAGAAAAATTTACTGGTAAAGGCTGCTATATTTACATTTTGTCTGA
ATATGATTAAAATGTTTTCTTGGATAATTTTACTTTAGAAAAGTTCTTAGAAACTTCTTT
ACCAGAGGATTTTTTTGCTGGGAATTGCCTTAATACAAATAAAATTAGAATTTTTGATTA
CCCATATATTCCATAAAATTTACCTCAGGAGGATATCATTAACCTTAATGATCCAAATAT
AGAAGAAATATTTAAAAAAGTTAATAATAAAATCAAAAACATGAATGAATAAGAATAACA
ACAATTAAACAGTTTAGCACTATAAATTCATTAATAATATTAAAAAGATGCAAATAAGTA
ATTTAATCCAATGAATAGCGAATCTTCAATGAGCGAAGAGGAGCCTGATTAAGAATCTAA
AAATATTTTATAAATGAATTTACAAAAGAAAATTGCAAAAAGCAAATTCTTGCCTAATGT
TTAAGGAATGGATATTGATGAATAAAATTAGCTATTGTTTAAAGAAATGGATTAGTTAGA
AAATAATTAAGATTATTAACTAGACAACACTCAAGATAACTAATTTTTTGCAAAATAAGA
AGACGTTTTAAATTGA