Identifiers and Description

Gene Model Identifier

TTHERM_00835340

Standard Name

LSM7 (Lsm (Like Sm) protein 7)

Aliases

PreTt24549 | 145.m00116

Description

Sm protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00835340

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16808.14.000904604388404e-59Sm protein (105 aa)
WormBaseWBGene000030817.002785992501305e-33locus:lsm-7 status:Confirmed
UniProt:Q23543 protein_id
:CAA93428.1
DictyBaseDDB_G02894992.998800627344286e-26lsm7 on chromosome: 5 position
2859869 to 2860286
OxytrichaContig18849.0.g1073.999672240330216e-26LSM domain
SGDYNL147W5.000468829272308e-18LSM7 Lsm (Like Sm) protein; pa
rt of heteroheptameric complex
es (Lsm2p-7p and either Lsm1p
or 8p): cytoplasmic Lsm1p comp
lex involved in mRNA decay; nu
clear Lsm8p complex part of U6
snRNP and possibly involved i
n processing tRNA, snoRNA, and
rRNA

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00835340(coding)
ATGTCAGGTGGTTAAAAGTAGTAAAAAGAGTCGATCATTAATCTTTCTTAATATGTTGGA
AAAGATATTCGTGTTAAATTTTAGGGAGGCAGAGAAGTGACAGGTGTTTTAAAAAGTTTT
GATAATTAACTCAATATGATTTTAGATGATTGCGTTGAAACTATAAGAGATAAAAATGAT
CCTTATTTGATGACAGAACAAAAAAGAAAGTTGAATTTAGTAGTTGTTAGAGGAACTTTG
GTTTCTACCATATTCCCAATGAGCGGCACAGAAATAATTGAAAATCCTTTTGTAAACATG
GAAGAATAGTGA


>TTHERM_00835340(protein)
MSGGQKQQKESIINLSQYVGKDIRVKFQGGREVTGVLKSFDNQLNMILDDCVETIRDKND
PYLMTEQKRKLNLVVVRGTLVSTIFPMSGTEIIENPFVNMEEQ


>TTHERM_00835340(gene)
ATGTCAGGTGGTTAAAAGTAGTAAAAAGAGTCGATCATTAATCTTTCTTAATATGTTGGA
AAAGATATTCGTGTTAAATTTTAGGGAGGCAGAGAAGTGACAGGTGTTTTAAAAAGTTTT
GATAATTAACTCAATATGATTTTAGATGATTGCGTTGAAACTATAAGAGGTAATTTAAAT
TTTAAAATAGAATTTGCTGCAAAAAAATAGTTTTAAGGAGAAGCCTCATTTAATTGAAAT
ATTTTATTAAAATAGATAAAAATGATCCTTATTTGATGACAGAACAAAAAAGAAAGTTGA
ATTTAGTAGTTGTTAGAGGAACTTTGGTAAATTTAAATCTATTTAATAAATAAATTAAAT
AAATGAGTAAATAAATATAAATAAATTATTAAAATGAACAGGTTTCTACCATATTCCCAA
TGAGCGGCACAGAAATAATTGAAAATCCTTTTGTAAACATGGAAGAATAGTGA