Identifiers and Description

Gene Model Identifier

TTHERM_00541550

Standard Name

LSF8 (Fusion of leishmanolysin-like peptidase and subtilisin-like proprotein convertase)

Aliases

PreTt15001 | 71.m00128 | 3729.m00010

Description

Fusion of leishmanolysin-like peptidase and subtilisin-like proprotein convertase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF09146 ) BmKK2 toxic
  • ( PF03128 ) CXCXC repeat
  • ( PF01457 ) Leishmanolysin
  • ( PF00008 ) EGF-like domain
  • ( PF07974 ) EGF-like domain
  • ( PF02822 ) Antistasin family
  • ( PF01033 ) Somatomedin B domain
  • ( PF01754 ) A20-like zinc finger
  • ( PF02363 ) Cysteine rich repeat
  • ( PF09257 ) BCMA, TALL-1 binding
  • ( PF00020 ) TNFR/NGFR cysteine-rich region
  • ( PF00757 ) Furin-like cysteine rich region
  • ( PF03860 ) Domain of Unknown Function (DUF326)
  • ( PF00053 ) Laminin EGF-like (Domains III and
  • ( PF08265 ) YL1 nuclear protein C-terminal domain
  • ( PF03302 ) Giardia variant-specific surface protein
  • ( PF00130 ) Phorbol esters/diacylglycerol binding domain (C1

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00541550

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17014.19.997093137033517e-262leishmanolysin family protein
(1343 aa)
Stentor CoeruleusSteCoe_190054.906094730649281e-35
OxytrichaContig169.0.g129.995528898049344e-31Tubulin-tyrosine ligase family
DictyBaseDDB_G02933642.000620012690291e-23sigB on chromosome: 6 position
2822106 to 2824254
WormBaseWBGene000127964.997543945741262e-17Leishmanolysin-like peptidase
status:Partially_confirmed
UniProt:O62446 protein_id:C
AB16471.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00541550(coding)
ATGAAAATAGTTTAAATACTAATTTTACTCACAAGTTTGTTAGTAAATATTCAATAGACT
AGACAATAATTTGTTAACACTTGCTTACAAGATGAGATTGACATGAATGAAATAGTTCCT
AAGGACTATTTAGAAACATTTGATGAGAACTTTGGAAACAGGAAACTCTAGAGTTCTAAA
CCTTAACCTATTAGGATCACTCTTGATTTTAATGAACTTGATAACTCTTAAAATGGAGAT
GGAATGACACCTTAAAAAAAAGAATACTTAAAGAAAATTATGTATGCTGCTCAAACATAC
CTGAATAAACTTATTAAAGTATATCCTAGACAAAAACCTAACACCTATAATTGGGGTGGT
GATAAATGCTTAGATGTTAAACTCCCTAACAATATAAAAACAGTTGGAATAGATAAATCG
GATTTACATATCTTTGTTACCTATTCAAATGAACCAAAAGCTTTTTATTTAGCAAATGCA
ATATGGTGCTCTTTAGATCCTAGACCTAATATTGGAAGAGTTAAATTTAATATTGCTGGT
ATGGATTTTGATGAATCATCAACTTAGTCTTTTTAAGATAATTTCTCAACTTCTTTACAT
GAAATTCTCCACATTTTAGGTTTTTCAGGTAGCAGTGTTTTTTTTTGGATTGATCCTGAT
ACAGATAAACCATATGGAAATAAGAATGTATTTAAAATTATGAAATAAGAAAGAAGATGG
GAAGTAGACAATGTTATTAAATTATTCTCTAAAAATATTTTGAAAGTATCTAGAAATCAC
TACAAATGTCCATCTATTGAAGGTATGTATCTTGAAAATTAAGGTGGTGGTGGCTCTATG
GGTTCTCATTGGGAAAGGGATTTACTTGGAAATGAATTTATGACAGGTAGTATTGTTTAT
GGTGTCTACACTATATCTAAATTTACAGCTGCTCTTCTCTTAGATACTGGTTATTATGCT
GAAATTAATTCTAACCTTCTTATGCCTATTTATTGGGGTAAAAATAAGGGATGTGATTTT
TTCAATAAAACTTGTAATACTGGAAAATATTTCCCTGAGTTCCCAGATGACAGTGTAAAA
GAATCTTGTGATTTCTTTTCTTTAGGTATTGGTGGTCTACATAATTATGATTACTTCTCT
TAATGTAAAACTATTTATTCATACTCAAATGCTTATTGCGAATCTGATTAGTTTAAACCT
GATGAAAGATTGAGATAAAATACTGGTACCGGATCAAGATGCTTTAGATCTAATGCTAAT
GTCAAAGGAAATGAAGTTTTAGATATGAATGGTAGATGCTTTAAGGCTTAATGTGCAGAT
GATCTATCTTCCATTAAAGTTAATGTATGGGGTGATGAATACGTTACTTGCAAATACCCC
AATTAAGTCATTAACTTAGCTGATCAAACTAAAACAACTCAAGGTACTATGAAATGTCCT
CATGATTTTGATTTGTTTTGTAATTTCCCTAAGTCATGCCCCAATAACTGCTCTAACAAT
GGTGTCTGTAATAATGGTTATTGTGTATGTCTCAAAGGATATGGTGGTGCTGATTGCTCT
AAAAGATGTGGTGAAGGTTAAGTTTGGGATGGTTCTCGTTGTGTTTATAACTGCCCCTCT
GGATAATTCAAAAACTTTGATAACACTTGCAAGCCCACTTGCCCATACAAATAATATAGA
GATAAAGCGACTGGTAGTTGTGTTCTCTGCTATGATAACTGTTCAGCATGCTTTGGCCCT
TCATACAATCAATGTTTATCTTGTAATGATAGATATTCGCTTTAAGGAAACTAATGTGTT
GATACTACCTGCCACTCTAGCTGCCAATCATGCTCTGGTCCAAATTCAAATCAATGTACT
TCTTGCCCTGCTGGCTAGTATTTGGACTCTAGAAAAACTTGCCAGCCATGCTAATATCCT
TGTGAAAATTGTTTCAACTCAGCTACAGAGTGTACAACTTGTGGATAAGGATATGAAATG
GATAAATTTATTGGTAAATGTGTATCTATGAATACATGCGATAGCTCTTGTCTTGAATGC
TCAACTTTTAGAGATCCCACTAAATGCACTTCTTGTAGAGATGGTTAATTCCTAAATAAA
AAAGGTAGATGTTAAAAATGTGACGAATCTTGTGCTACATGTGCTGAAAGAGAAAATAAA
TGCATAAAATGTGCTGACGGATGGGAATATGATGAATATAAAAAAAGATGTCGTATGGAT
TGCCATGAAAGTTGTGATACATGTACAGCTCGTTAAAATCCGATAGCTTGCAAAACGTGT
GCACATAATTACGTTATGTAGAATAATCTATGTATACCTTGCGATAAAAGTTGTTATGGA
TGTACAGAAAATCCTAAAAAATGTACTAATTGTAATAGAAAGTATAAACTAGATTCAAAT
TATCAAACTTGTGTCCCCATTTGTAATTCTGACGAATTCCAAGATGGAAATGGAAACTGT
TAAAAATGTGCATCTCCTTGCGCCACATGCGAATATTATAATTACTATTGTAATAGTTGT
ATAGCTGGTTATACTTATGAAGCCTAATATAAATCTTGTTAGCCTGTTACAAATAAATGT
CATGAAAGTTGTGGACAATGTAATAGATATGATGACCATAGTGCATGTACATCTTGTAGG
GATGGAATGTTCTTGTTATCTGGAAGATGTCGATACTGCAGTAATAAATGCAAAACTTGT
GATAGAGATGCTAATATTTGTACATCTTGCAGAAGGTATGAGTTCTTATAAAATAGAGAA
TGTATGAAATGTCATAGTTCTTGTTTGACTTGTGATGGAATTTCAACAAACTGTACTTCT
TGTCAAAATGGATTCTCAAAAGACCCAAAGACAGGTCTTTGTGTAGACAGTACACTTGTT
TGCAAAACAGATGAATACATGGATAGAAATTATAAATGTTAGAAATGTAGTTCACCTTGT
GCTTCTTGTTTCTACTATCATAACAGATGTTCTAGCTGTATTTCTGGTTATAAATTGAAC
ACTCAAATATACTAATGTGAATATGATTATCCTATATGCCAAGATGGATAGTTCTTAGAT
TAGGATAATAAATGTAAGCCTTGTGATTCCTCTTGTGCTACTTGTGATTAAACAAGTAAA
AGATGTACAAGTTGTAAATATGGTTTTGTTCTGTCAAGATACACTTGCTAAGCAGCTAAT
TGCTAAGATGGAACCTTCATGAACTAATAAGGAAGATGCTAAAGATGTAGTGAGTCTTGC
TCTAAGTGTGTAAACTATTCAGATAACTGTACTGAATGTGCTAGTGGATATACTTTAGAT
ACAGGAACTTAAAGATGCATTAAAAACTAAAATAATTAGTAATGTCATCCCTCTTGTAAA
GAATGCAACTAACCTAATAATGTTTCTGCCTGCAAATCCTGTAATGATGGACAATATTTA
AATAGAGGTTAGTGTCTTTAATGTAATAGCTCTTGTTTAACATGTGACAGGTATTCAGAT
TTTTGTACTTCTTGTTAGCAAGGTTATAATCTAGATAGCACCTACGGTTAATGTACTCCT
GATTGCAAAAAAAGTGAATATTTAGACTACTAAGATAACAAATGCAAGCCTTGCACATCT
AATTGTGGAAGTTGCGAATACTACCCGGATAGATGTCTTAGCTGTATTTCAGGATTTAAG
TATAATAAAGAAGGATATAGCTGTGAAAAAGTTTGCTAGCCTGGATAATATGTTGATAGA
GATTAGACATGCAAACCTTGCTCATCTCCATGTACAACTTGCGAATATTATGACAACAGA
TGTTTGAGTTGTGTTTCAGGTTATACTTACAATAACTACTATTGCTAATAGAATTCAAAG
TAAAGTGCAAGAGGTTGTCACGAATCTTGTAATACCTGTACAAAAGCTATGGATCCTCGC
TCATGTGATTCCTGTAGAGAAGGATATGAATTAATAAATGGGGCTTGCCTAAGAAAGAGA
GGCAACTATTCTGGCCCTAAAAATTGA


>TTHERM_00541550(protein)
MKIVQILILLTSLLVNIQQTRQQFVNTCLQDEIDMNEIVPKDYLETFDENFGNRKLQSSK
PQPIRITLDFNELDNSQNGDGMTPQKKEYLKKIMYAAQTYLNKLIKVYPRQKPNTYNWGG
DKCLDVKLPNNIKTVGIDKSDLHIFVTYSNEPKAFYLANAIWCSLDPRPNIGRVKFNIAG
MDFDESSTQSFQDNFSTSLHEILHILGFSGSSVFFWIDPDTDKPYGNKNVFKIMKQERRW
EVDNVIKLFSKNILKVSRNHYKCPSIEGMYLENQGGGGSMGSHWERDLLGNEFMTGSIVY
GVYTISKFTAALLLDTGYYAEINSNLLMPIYWGKNKGCDFFNKTCNTGKYFPEFPDDSVK
ESCDFFSLGIGGLHNYDYFSQCKTIYSYSNAYCESDQFKPDERLRQNTGTGSRCFRSNAN
VKGNEVLDMNGRCFKAQCADDLSSIKVNVWGDEYVTCKYPNQVINLADQTKTTQGTMKCP
HDFDLFCNFPKSCPNNCSNNGVCNNGYCVCLKGYGGADCSKRCGEGQVWDGSRCVYNCPS
GQFKNFDNTCKPTCPYKQYRDKATGSCVLCYDNCSACFGPSYNQCLSCNDRYSLQGNQCV
DTTCHSSCQSCSGPNSNQCTSCPAGQYLDSRKTCQPCQYPCENCFNSATECTTCGQGYEM
DKFIGKCVSMNTCDSSCLECSTFRDPTKCTSCRDGQFLNKKGRCQKCDESCATCAERENK
CIKCADGWEYDEYKKRCRMDCHESCDTCTARQNPIACKTCAHNYVMQNNLCIPCDKSCYG
CTENPKKCTNCNRKYKLDSNYQTCVPICNSDEFQDGNGNCQKCASPCATCEYYNYYCNSC
IAGYTYEAQYKSCQPVTNKCHESCGQCNRYDDHSACTSCRDGMFLLSGRCRYCSNKCKTC
DRDANICTSCRRYEFLQNRECMKCHSSCLTCDGISTNCTSCQNGFSKDPKTGLCVDSTLV
CKTDEYMDRNYKCQKCSSPCASCFYYHNRCSSCISGYKLNTQIYQCEYDYPICQDGQFLD
QDNKCKPCDSSCATCDQTSKRCTSCKYGFVLSRYTCQAANCQDGTFMNQQGRCQRCSESC
SKCVNYSDNCTECASGYTLDTGTQRCIKNQNNQQCHPSCKECNQPNNVSACKSCNDGQYL
NRGQCLQCNSSCLTCDRYSDFCTSCQQGYNLDSTYGQCTPDCKKSEYLDYQDNKCKPCTS
NCGSCEYYPDRCLSCISGFKYNKEGYSCEKVCQPGQYVDRDQTCKPCSSPCTTCEYYDNR
CLSCVSGYTYNNYYCQQNSKQSARGCHESCNTCTKAMDPRSCDSCREGYELINGACLRKR
GNYSGPKN


>TTHERM_00541550(gene)
ATGAAAATAGTTTAAATACTAATTTTACTCACAAGTTTGTTAGTAAATATTCAATAGACT
AGACAATAATTTGTTAACACTTGCTTACAAGATGAGATTGACATGAATGAAATAGTTCCT
AAGGACTATTTAGAAACATTTGATGAGAACTTTGGAAACAGGAAACTCTAGAGTTCTAAA
CCTTAACCTATTAGGATCACTCTTGATTTTAATGAACTTGATAACTCTTAAAATGGAGAT
GGAATGACACCTTAAAAAAAAGAATACTTAAAGAAAATTATGTATGCTGCTCAAACATAC
CTGAATAAACTTATTAAAGTATATCCTAGACAAAAACCTAACACCTATAATTGGGGTGGT
GATAAATGCTTAGATGTTAAACTCCCTAACAATATAAAAACAGTTGGAATAGATAAATCG
GATTTACATATCTTTGTTACCTATTCAAATGAACCAAAAGCTTTTTATTTAGCAAATGCA
AGTAATAAATTTTATTCTCAATAAATAGTATATTTTTAAACATTTTAAAAAAATTAATTA
GTATGGTGCTCTTTAGATCCTAGACCTAATATTGGAAGAGTTAAATTTAATATTGCTGGT
ATGGATTTTGATGAATCATCAACTTAGTCTTTTTAAGATAATTTCTCAACTTCTTTACAT
GAAATTCTCCACATTTTAGGTTTTTCAGGTAGCAGTGTTTTTTTTTGGATTGATCCTGAT
ACAGATAAACCATATGGAAATAAGAATGTATTTAAAATTATGAAATAAGAAAGAAGATGG
GAAGTAGACAATGTTATTAAATTATTCTCTAAAAATATTTTGAAAGTATCTAGAAATCAC
TACAAATGTCCATCTATTGAAGGTATGTATCTTGAAAATTAAGGTGGTGGTGGCTCTATG
GGTTCTCATTGGGAAAGGGATTTACTTGGAAATGAATTTATGACAGGTAGTATTGTTTAT
GGTGTCTACACTATATCTAAATTTACAGCTGCTCTTCTCTTAGATACTGGTTATTATGCT
GAAATTAATTCTAACCTTCTTATGCCTATTTATTGGGGTAAAAATAAGGGATGTGATTTT
TTCAATAAAACTTGTAATACTGGAAAATATTTCCCTGAGTTCCCAGATGACAGTGTAAAA
GAATCTTGTGATTTCTTTTCTTTAGGTATTGGTGGTCTACATAATTATGATTACTTCTCT
TAATGTAAAACTATTTATTCATACTCAAATGCTTATTGCGAATCTGATTAGTTTAAACCT
GATGAAAGATTGAGATAAAATACTGGTACCGGATCAAGATGCTTTAGATCTAATGCTAAT
GTCAAAGGAAATGAAGTTTTAGATATGAATGGTAGATGCTTTAAGGCTTAATGTGCAGAT
GATCTATCTTCCATTAAAGTTAATGTATGGGGTGATGAATACGTTACTTGCAAATACCCC
AATTAAGTCATTAACTTAGCTGATCAAACTAAAACAACTCAAGGTACTATGAAATGTCCT
CATGATTTTGATTTGTTTTGTAATTTCCCTAAGTCATGCCCCAATAACTGCTCTAACAAT
GGTGTCTGTAATAATGGTTATTGTGTATGTCTCAAAGGATATGGTGGTGCTGATTGCTCT
AAAAGATGTGGTGAAGGTTAAGTTTGGGATGGTTCTCGTTGTGTTTATAACTGCCCCTCT
GGATAATTCAAAAACTTTGATAACACTTGCAAGCCCACTTGCCCATACAAATAATATAGA
GATAAAGCGACTGGTAGTTGTGTTCTCTGCTATGATAACTGTTCAGCATGCTTTGGCCCT
TCATACAATCAATGTTTATCTTGTAATGATAGATATTCGCTTTAAGGAAACTAATGTGTT
GATACTACCTGCCACTCTAGCTGCCAATCATGCTCTGGTCCAAATTCAAATCAATGTACT
TCTTGCCCTGCTGGCTAGTATTTGGACTCTAGAAAAACTTGCCAGCCATGCTAATATCCT
TGTGAAAATTGTTTCAACTCAGCTACAGAGTGTACAACTTGTGGATAAGGATATGAAATG
GATAAATTTATTGGTAAATGTGTATCTATGAATACATGCGATAGCTCTTGTCTTGAATGC
TCAACTTTTAGAGATCCCACTAAATGCACTTCTTGTAGAGATGGTTAATTCCTAAATAAA
AAAGGTAGATGTTAAAAATGTGACGAATCTTGTGCTACATGTGCTGAAAGAGAAAATAAA
TGCATAAAATGTGCTGACGGATGGGAATATGATGAATATAAAAAAAGATGTCGTATGGAT
TGCCATGAAAGTTGTGATACATGTACAGCTCGTTAAAATCCGATAGCTTGCAAAACGTGT
GCACATAATTACGTTATGTAGAATAATCTATGTATACCTTGCGATAAAAGTTGTTATGGA
TGTACAGAAAATCCTAAAAAATGTACTAATTGTAATAGAAAGTATAAACTAGATTCAAAT
TATCAAACTTGTGTCCCCATTTGTAATTCTGACGAATTCCAAGATGGAAATGGAAACTGT
TAAAAATGTGCATCTCCTTGCGCCACATGCGAATATTATAATTACTATTGTAATAGTTGT
ATAGCTGGTTATACTTATGAAGCCTAATATAAATCTTGTTAGCCTGTTACAAATAAATGT
CATGAAAGTTGTGGACAATGTAATAGATATGATGACCATAGTGCATGTACATCTTGTAGG
GATGGAATGTTCTTGTTATCTGGAAGATGTCGATACTGCAGTAATAAATGCAAAACTTGT
GATAGAGATGCTAATATTTGTACATCTTGCAGAAGGTATGAGTTCTTATAAAATAGAGAA
TGTATGAAATGTCATAGTTCTTGTTTGACTTGTGATGGAATTTCAACAAACTGTACTTCT
TGTCAAAATGGATTCTCAAAAGACCCAAAGACAGGTCTTTGTGTAGACAGTACACTTGTT
TGCAAAACAGATGAATACATGGATAGAAATTATAAATGTTAGAAATGTAGTTCACCTTGT
GCTTCTTGTTTCTACTATCATAACAGATGTTCTAGCTGTATTTCTGGTTATAAATTGAAC
ACTCAAATATACTAATGTGAATATGATTATCCTATATGCCAAGATGGATAGTTCTTAGAT
TAGGATAATAAATGTAAGCCTTGTGATTCCTCTTGTGCTACTTGTGATTAAACAAGTAAA
AGATGTACAAGTTGTAAATATGGTTTTGTTCTGTCAAGATACACTTGCTAAGCAGCTAAT
TGCTAAGATGGAACCTTCATGAACTAATAAGGAAGATGCTAAAGATGTAGTGAGTCTTGC
TCTAAGTGTGTAAACTATTCAGATAACTGTACTGAATGTGCTAGTGGATATACTTTAGAT
ACAGGAACTTAAAGATGCATTAAAAACTAAAATAATTAGTAATGTCATCCCTCTTGTAAA
GAATGCAACTAACCTAATAATGTTTCTGCCTGCAAATCCTGTAATGATGGACAATATTTA
AATAGAGGTTAGTGTCTTTAATGTAATAGCTCTTGTTTAACATGTGACAGGTATTCAGAT
TTTTGTACTTCTTGTTAGCAAGGTTATAATCTAGATAGCACCTACGGTTAATGTACTCCT
GATTGCAAAAAAAGTGAATATTTAGACTACTAAGATAACAAATGCAAGCCTTGCACATCT
AATTGTGGAAGTTGCGAATACTACCCGGATAGATGTCTTAGCTGTATTTCAGGATTTAAG
TATAATAAAGAAGGATATAGCTGTGAAAAAGTTTGCTAGCCTGGATAATATGTTGATAGA
GATTAGACATGCAAACCTTGCTCATCTCCATGTACAACTTGCGAATATTATGACAACAGA
TGTTTGAGTTGTGTTTCAGGTTATACTTACAATAACTACTATTGCTAATAGAATTCAAAG
TAAAGTGCAAGAGGTTGTCACGAATCTTGTAATACCTGTACAAAAGCTATGGATCCTCGC
TCATGTGATTCCTGTAGAGAAGGATATGAATTAATAAATGGGGCTTGCCTAAGAAAGAGA
GGCAACTATTCTGGCCCTAAAAATTGA