Identifiers and Description

Gene Model Identifier

TTHERM_00541530

Standard Name

LSF6 (Fusion of leishmanolysin-like peptidase and subtilisin-like proprotein convertase)

Aliases

PreTt14999 | 71.m00126 | 3729.m00008

Description

Fusion of leishmanolysin-like peptidase and subtilisin-like proprotein convertase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF09132 ) BmKX
  • ( PF06410 ) Gurmarin
  • ( PF09146 ) BmKK2 toxic
  • ( PF07699 ) GCC2 and GCC3
  • ( PF01457 ) Leishmanolysin
  • ( PF00008 ) EGF-like domain
  • ( PF00131 ) Metallothionein
  • ( PF07974 ) EGF-like domain
  • ( PF02822 ) Antistasin family
  • ( PF09257 ) BCMA, TALL-1 binding
  • ( PF01286 ) XPA protein N-terminal
  • ( PF02008 ) CXXC zinc finger domain
  • ( PF00020 ) TNFR/NGFR cysteine-rich region
  • ( PF00757 ) Furin-like cysteine rich region
  • ( PF00053 ) Laminin EGF-like (Domains III and
  • ( PF07754 ) Domain of unknown function (DUF1610)
  • ( PF08265 ) YL1 nuclear protein C-terminal domain
  • ( PF07562 ) Nine Cysteines Domain of family
  • ( PF03302 ) Giardia variant-specific surface protein
  • ( PF00220 ) Neurohypophysial hormones, N-terminal Domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 68.9%

TetraMine Data

TTHERM_00541530

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17014.19.997093137033517e-262leishmanolysin family protein
(1343 aa)
Stentor CoeruleusSteCoe_243103.3057006267607343e-37
OxytrichaContig169.0.g121.9993007828132465e-27Tubulin-tyrosine ligase family
DictyBaseDDB_G02933645.002171138422328e-22sigB on chromosome: 6 position
2822106 to 2824254
WormBaseWBGene000127965.000468829272308e-18Leishmanolysin-like peptidase
status:Partially_confirmed
UniProt:O62446 protein_id:C
AB16471.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00541530(coding)
ATGTAAATAATTTTGAAAATGAACAAATCTGCTATATTAATGCTTTATACTATCTTCATA
GTATATGCATAAAATGTTAATAAATAAGAAGCAGTGAACTCTTGTTTATAAGATGAAATA
GATTTAAGTGAAATGGTTCCCAAGGATTATTTAGAAACCTTTGAAGAGAAATATGGAAAC
AGGATACTTAAAAGTTATGAACCTTAACCAATTAGAATTACTCTAGATTTCTATGAGCTT
GAAAATCCTCTAAATGGTGATGGAATGACTCCTAGTAAAAAGGAATACTTAAAAAAAATC
ATGTATGCTGCTCAAATATATTTAACTAAGCTAATCAAAGTTTATCCAAGACAAGGACCT
CTTAAATATATTTGGGATAATGAAAATTGTTATGATATTAAAATCCCGTAGTACATAAAA
AAAATAGGTGTTGAGAATTCTGATTTACATATATTTGTTACATACTCAAATTTACCTAAA
TCCTAGACTTTAGCAAATGCAATCTGGTGTTAGTTAGATCCCTAGCCAAATGTTGGAAGA
GTCCTATTTAATATAGGCGCTATGGATATAGATGAATCTTCAACTTAATCCTTCTAAGAT
AATTTCTCTACTTCACTACATGAAATTTTACATATTCTAGGCTTTACAGGTAAAAGCGTC
TAATACTGGATCGATCCTGATACAAATAAACCTTATGGAGAAAATAATGTAAGTAAGATT
TTGACAAGTGAAACAAGATGGTAAATAGATAATGTTCTAAAAATATCTTCTAAAAATATT
TTAAGAGTCTCTAGAAATCATTATAACTGTCCTTCAATTAATGGTATGTATCTAGAAAAT
TAAGGAGGATCCGGATCTATGGGTTCTCACTGGGAAAGAGATTTACTTTCTAATGAATTC
ATGACTGCTAGTATTGTTTAACGCATTTATTCTATTTCTGAATTTACAGCTGCTTTACTT
CTTGATACTGGCTACTATGCTGAAATCAATTCTAATTTTCTCAATCCTATATATTGGGGT
AAAAATAAAGGATGTGATTTTTTTAACAATTCATGTAATACTGCAAAGGACTTACATGAA
TTCCCAAATAATACTTAAGAATCTTGTGATTTTTACTATGAAGGAATTGGCAGTCTCTAA
AATTATGATGATTTTTCTTAATGTAAAATAATTTATACATATAGAAATGGTTATTGTGAT
TCATATTAATTTAAACCTGATGAAATTCTAAGATAAAACACTGGAAAAGGGTCAAAATGT
TTCAGATCTAATGCAAACATCAAGGGTCATGAAATTTTAGATATAAAAGGAAGATGCTTT
AAAGCTTAATGTGCAAATGATTTATCATCTATTAAAGTAAATGTTTGGGATGATGAATAT
GTAACTTGTAATTATCCTAATCAAGTTATTAACTTAGCTGAATAAACTAAAACTACTTAA
GGTACTATGAGATGTCCTCATGATTTTGACTTATTTTGCAATTTCCCTAAGTCTTGTCCA
AATAATTGCTCTAATAGTGGTGTGTGTAATAATGGCTATTGTGTTTGCCTCAAAGGATAT
GCTGGAGCTGATTGCTCTTAAAGATGTCCTGAAGAATATGTCTGGGATAGCAATAGATGT
GTTTAAAATTGTCCACGTGGATAGTTTAAAAATTTAGATAATACATGTAAACCTACTTGT
CCTTATAAGTATTATGGAGAAAAATTTACAGGTAACTGTACATTGTGCTCAGTAAACTGC
TCAGCTTGCTTTGGTTCAGCTTCTAATTAATGTCTTTCTTGTAATGATGGCTATTCTCTT
TAAGGAAATAAATGTGTTGAAATGATTTGTTATTCAAGTTGTCAATCGTGCTCAGGACCT
AATTCAAACTAATGCACTTCATGTCCAGCTGGAAAATATTTAGATTCTAGAAATACATGT
CAACATTGCTAATCACCTTGTGAAAATTGCTTCAACTCATCTACTGAATGTACTACTTGC
AGTTAGGGATACTTTATGGATAGATTTAGTGGAAAATGTGTTTCTGAAAATTCTTGTGAT
AGTTCTTGTCTTGACTGTTCTGCTTTTAGGGATCCTACAAAATGTACTTTATGTCGAGAT
GGTTTTTTCTTAAACGAATATGGGGAATGCTAAAAATGTGACTAATCTTGCTCCATCTGT
ACAATGAGAGGTAATAATTGTATTAAATGTGTTTAAGGTTGGGAATATAGCGCTAGTAAA
AAAAGGTGTTTCTATAACTGCCATGAAAGTTGTGATACATGTACATTAGTTTTAGACCCA
AAAGCTTGTATAAGATGTGCTTTTAATCATGTGATGTCAAATAATTAATGCGTTCCTTGT
GATAAAAGCTGCCATGGTTGTACAGAAAATCCTAAAAAATGCAACGAATGCGCAAAAGGA
TACTATTTAGATTCATATTATGATATATGTGTACCTACATGTAGATCAGATGAGTTCCAA
GATTCAAAAGGGAACTGCTAAAAATGTTAATAACCATGTGCTACTTGCCAATTTTACAGT
GATAATTGCATTACCTGCTTATCAGGTTATATTTATGATTTTTATTATAAATCTTGCATT
CCTACAAATAGTTTTTGTCATGAAACCTGTGATTAATGTAGTAGAAATAATGATCCCTAC
TCATGCACTAAATGTAAAGATGGGATGTATTTGATAAATGGTGAATGCTATTAATGTAGC
GGTAAATGTTAAACTTGTGAAAAAAATGCTTTTTAATGTACTTCTTGCAAATAGAAATAA
TTTTTAAACAACTATGAATGTCTTTAATGTCACAGTTCTTGCTAAACATGTTTTGGAATT
TCAACAAATTGCACTTCTTGCTAATAAGGTTTCTCAAAAGATCCTTTGACAGGTCTTTGC
ATAAATAATTTACCTAGATGTAAAAGTAACGAATATTTGGATAAAGATTATCAATGTTAA
TAATGTGAATTACCTTGCGCTTCTTGCTTCAATTTACCAAATAAATGTTAAAGCTGTATT
TCTGGTTATATTTACAATTCTTAAACATTTTAGTGTTAATAATTTAATCCGGTTTGTTAT
GAAGGAGAATTCTTGGATTTTGATAATAAATGTAAATATTGTGATCGAATTTGTGCCACT
TGTGATATATACAGTAATAGATGCACAAGTTGTAAACATGGCTTTACTCTTTCAAAAAAT
TCTTGTTATGAAGATAAATGCTAAGATGGATCATTCATTAATTAGTATGGAAGATGTTAA
AAATGTAGCAATTCATGTAGAAAATGTATAAATTATTATGATAACTGCACTGAATGTGCT
GATGGATATTCTTATAATATAAGAACATAGACATGTGTTATAAATGAAAGCTATTAAAAA
TGTCATCATACTTGTAAATAATGCAATTAAAGTAATAATGCATTTGCTTGCTAATCATGT
TATGATTGTAACTATTTAAGCAATGGATAATGCCTTCCATGCAAAAATAATTGTTAGACT
TGTGACAGATATTCTGATTTTTGCACTTCGTGTTAAAATGGATTTAAATTAAACAGAAAT
TAAGGTAGATGTATCCCAGAATGTAAGTATGGTGAATACTTAGACTAGAGTGTTAATTTA
TGTAAACAATGTGCATATCCTTGTGAGAGCTGTGAATTTAATCCAAGTTAGTGTACTAGC
TGTATTTAAGGATATAATTATAACAGTAAAAGTTAAAGCTGTACCATTCTTTGCCGACTT
GGAGAGTATTCTGATAGAGGTTTATATTGCAAACCATGCTCGTTTCCTTGTGAGACTTGT
GAAGATTATGATGACAAATGCTTAAGTTGTGTTTAAGATTACACTTACAGCAATTATCAA
TGTTTAAAAAATTCTAAAACTAATTTAAGATATTGTCATGAATCTTGTAATTCTTGTATT
AGAGCAATGGATCCTAATTCATGTGATTCTTGTAAAGAAGGATACATTTTAATAAATAGA
ACTTGCCAAAAGAAGAAAGGAAATTATTTTGAACCAAAAAATTGA


>TTHERM_00541530(protein)
MQIILKMNKSAILMLYTIFIVYAQNVNKQEAVNSCLQDEIDLSEMVPKDYLETFEEKYGN
RILKSYEPQPIRITLDFYELENPLNGDGMTPSKKEYLKKIMYAAQIYLTKLIKVYPRQGP
LKYIWDNENCYDIKIPQYIKKIGVENSDLHIFVTYSNLPKSQTLANAIWCQLDPQPNVGR
VLFNIGAMDIDESSTQSFQDNFSTSLHEILHILGFTGKSVQYWIDPDTNKPYGENNVSKI
LTSETRWQIDNVLKISSKNILRVSRNHYNCPSINGMYLENQGGSGSMGSHWERDLLSNEF
MTASIVQRIYSISEFTAALLLDTGYYAEINSNFLNPIYWGKNKGCDFFNNSCNTAKDLHE
FPNNTQESCDFYYEGIGSLQNYDDFSQCKIIYTYRNGYCDSYQFKPDEILRQNTGKGSKC
FRSNANIKGHEILDIKGRCFKAQCANDLSSIKVNVWDDEYVTCNYPNQVINLAEQTKTTQ
GTMRCPHDFDLFCNFPKSCPNNCSNSGVCNNGYCVCLKGYAGADCSQRCPEEYVWDSNRC
VQNCPRGQFKNLDNTCKPTCPYKYYGEKFTGNCTLCSVNCSACFGSASNQCLSCNDGYSL
QGNKCVEMICYSSCQSCSGPNSNQCTSCPAGKYLDSRNTCQHCQSPCENCFNSSTECTTC
SQGYFMDRFSGKCVSENSCDSSCLDCSAFRDPTKCTLCRDGFFLNEYGECQKCDQSCSIC
TMRGNNCIKCVQGWEYSASKKRCFYNCHESCDTCTLVLDPKACIRCAFNHVMSNNQCVPC
DKSCHGCTENPKKCNECAKGYYLDSYYDICVPTCRSDEFQDSKGNCQKCQQPCATCQFYS
DNCITCLSGYIYDFYYKSCIPTNSFCHETCDQCSRNNDPYSCTKCKDGMYLINGECYQCS
GKCQTCEKNAFQCTSCKQKQFLNNYECLQCHSSCQTCFGISTNCTSCQQGFSKDPLTGLC
INNLPRCKSNEYLDKDYQCQQCELPCASCFNLPNKCQSCISGYIYNSQTFQCQQFNPVCY
EGEFLDFDNKCKYCDRICATCDIYSNRCTSCKHGFTLSKNSCYEDKCQDGSFINQYGRCQ
KCSNSCRKCINYYDNCTECADGYSYNIRTQTCVINESYQKCHHTCKQCNQSNNAFACQSC
YDCNYLSNGQCLPCKNNCQTCDRYSDFCTSCQNGFKLNRNQGRCIPECKYGEYLDQSVNL
CKQCAYPCESCEFNPSQCTSCIQGYNYNSKSQSCTILCRLGEYSDRGLYCKPCSFPCETC
EDYDDKCLSCVQDYTYSNYQCLKNSKTNLRYCHESCNSCIRAMDPNSCDSCKEGYILINR
TCQKKKGNYFEPKN


>TTHERM_00541530(gene)
ATGTAAATAATTTTGAAAATGAACAAATCTGCTATATTAATGCTTTATACTATCTTCATA
GTATATGCATAAAATGTTAATAAATAAGAAGCAGTGAACTCTTGTTTATAAGATGAAATA
GATTTAAGTGAAATGGTTCCCAAGGATTATTTAGAAACCTTTGAAGAGAAATATGGAAAC
AGGATACTTAAAAGTTATGAACCTTAACCAATTAGAATTACTCTAGATTTCTATGAGCTT
GAAAATCCTCTAAATGGTGATGGAATGACTCCTAGTAAAAAGGAATACTTAAAAAAAATC
ATGTATGCTGCTCAAATATATTTAACTAAGCTAATCAAAGTTTATCCAAGACAAGGACCT
CTTAAATATATTTGGGATAATGAAAATTGTTATGATATTAAAATCCCGTAGTACATAAAA
AAAATAGGTGTTGAGAATTCTGATTTACATATATTTGTTACATACTCAAATTTACCTAAA
TCCTAGACTTTAGCAAATGCAAGTAAGCTTTATTATGTAAAAATTTTAATTAACAATTTT
TTAATCTTTGAATAGTCTGGTGTTAGTTAGATCCCTAGCCAAATGTTGGAAGAGTCCTAT
TTAATATAGGCGCTATGGATATAGATGAATCTTCAACTTAATCCTTCTAAGATAATTTCT
CTACTTCACTACATGAAATTTTACATATTCTAGGCTTTACAGGTAAAAGCGTCTAATACT
GGATCGATCCTGATACAAATAAACCTTATGGAGAAAATAATGTAAGTAAGATTTTGACAA
GTGAAACAAGATGGTAAATAGATAATGTTCTAAAAATATCTTCTAAAAATATTTTAAGAG
TCTCTAGAAATCATTATAACTGTCCTTCAATTAATGGTATGTATCTAGAAAATTAAGGAG
GATCCGGATCTATGGGTTCTCACTGGGAAAGAGATTTACTTTCTAATGAATTCATGACTG
CTAGTATTGTTTAACGCATTTATTCTATTTCTGAATTTACAGCTGCTTTACTTCTTGATA
CTGGCTACTATGCTGAAATCAATTCTAATTTTCTCAATCCTATATATTGGGGTAAAAATA
AAGGATGTGATTTTTTTAACAATTCATGTAATACTGCAAAGGACTTACATGAATTCCCAA
ATAATACTTAAGAATCTTGTGATTTTTACTATGAAGGAATTGGCAGTCTCTAAAATTATG
ATGATTTTTCTTAATGTAAAATAATTTATACATATAGAAATGGTTATTGTGATTCATATT
AATTTAAACCTGATGAAATTCTAAGATAAAACACTGGAAAAGGGTCAAAATGTTTCAGAT
CTAATGCAAACATCAAGGGTCATGAAATTTTAGATATAAAAGGAAGATGCTTTAAAGCTT
AATGTGCAAATGATTTATCATCTATTAAAGTAAATGTTTGGGATGATGAATATGTAACTT
GTAATTATCCTAATCAAGTTATTAACTTAGCTGAATAAACTAAAACTACTTAAGGTACTA
TGAGATGTCCTCATGATTTTGACTTATTTTGCAATTTCCCTAAGTCTTGTCCAAATAATT
GCTCTAATAGTGGTGTGTGTAATAATGGCTATTGTGTTTGCCTCAAAGGATATGCTGGAG
CTGATTGCTCTTAAAGATGTCCTGAAGAATATGTCTGGGATAGCAATAGATGTGTTTAAA
ATTGTCCACGTGGATAGTTTAAAAATTTAGATAATACATGTAAACCTACTTGTCCTTATA
AGTATTATGGAGAAAAATTTACAGGTAACTGTACATTGTGCTCAGTAAACTGCTCAGCTT
GCTTTGGTTCAGCTTCTAATTAATGTCTTTCTTGTAATGATGGCTATTCTCTTTAAGGAA
ATAAATGTGTTGAAATGATTTGTTATTCAAGTTGTCAATCGTGCTCAGGACCTAATTCAA
ACTAATGCACTTCATGTCCAGCTGGAAAATATTTAGATTCTAGAAATACATGTCAACATT
GCTAATCACCTTGTGAAAATTGCTTCAACTCATCTACTGAATGTACTACTTGCAGTTAGG
GATACTTTATGGATAGATTTAGTGGAAAATGTGTTTCTGAAAATTCTTGTGATAGTTCTT
GTCTTGACTGTTCTGCTTTTAGGGATCCTACAAAATGTACTTTATGTCGAGATGGTTTTT
TCTTAAACGAATATGGGGAATGCTAAAAATGTGACTAATCTTGCTCCATCTGTACAATGA
GAGGTAATAATTGTATTAAATGTGTTTAAGGTTGGGAATATAGCGCTAGTAAAAAAAGGT
GTTTCTATAACTGCCATGAAAGTTGTGATACATGTACATTAGTTTTAGACCCAAAAGCTT
GTATAAGATGTGCTTTTAATCATGTGATGTCAAATAATTAATGCGTTCCTTGTGATAAAA
GCTGCCATGGTTGTACAGAAAATCCTAAAAAATGCAACGAATGCGCAAAAGGATACTATT
TAGATTCATATTATGATATATGTGTACCTACATGTAGATCAGATGAGTTCCAAGATTCAA
AAGGGAACTGCTAAAAATGTTAATAACCATGTGCTACTTGCCAATTTTACAGTGATAATT
GCATTACCTGCTTATCAGGTTATATTTATGATTTTTATTATAAATCTTGCATTCCTACAA
ATAGTTTTTGTCATGAAACCTGTGATTAATGTAGTAGAAATAATGATCCCTACTCATGCA
CTAAATGTAAAGATGGGATGTATTTGATAAATGGTGAATGCTATTAATGTAGCGGTAAAT
GTTAAACTTGTGAAAAAAATGCTTTTTAATGTACTTCTTGCAAATAGAAATAATTTTTAA
ACAACTATGAATGTCTTTAATGTCACAGTTCTTGCTAAACATGTTTTGGAATTTCAACAA
ATTGCACTTCTTGCTAATAAGGTTTCTCAAAAGATCCTTTGACAGGTCTTTGCATAAATA
ATTTACCTAGATGTAAAAGTAACGAATATTTGGATAAAGATTATCAATGTTAATAATGTG
AATTACCTTGCGCTTCTTGCTTCAATTTACCAAATAAATGTTAAAGCTGTATTTCTGGTT
ATATTTACAATTCTTAAACATTTTAGTGTTAATAATTTAATCCGGTTTGTTATGAAGGAG
AATTCTTGGATTTTGATAATAAATGTAAATATTGTGATCGAATTTGTGCCACTTGTGATA
TATACAGTAATAGATGCACAAGTTGTAAACATGGCTTTACTCTTTCAAAAAATTCTTGTT
ATGAAGATAAATGCTAAGATGGATCATTCATTAATTAGTATGGAAGATGTTAAAAATGTA
GCAATTCATGTAGAAAATGTATAAATTATTATGATAACTGCACTGAATGTGCTGATGGAT
ATTCTTATAATATAAGAACATAGACATGTGTTATAAATGAAAGCTATTAAAAATGTCATC
ATACTTGTAAATAATGCAATTAAAGTAATAATGCATTTGCTTGCTAATCATGTTATGATT
GTAACTATTTAAGCAATGGATAATGCCTTCCATGCAAAAATAATTGTTAGACTTGTGACA
GATATTCTGATTTTTGCACTTCGTGTTAAAATGGATTTAAATTAAACAGAAATTAAGGTA
GATGTATCCCAGAATGTAAGTATGGTGAATACTTAGACTAGAGTGTTAATTTATGTAAAC
AATGTGCATATCCTTGTGAGAGCTGTGAATTTAATCCAAGTTAGTGTACTAGCTGTATTT
AAGGATATAATTATAACAGTAAAAGTTAAAGCTGTACCATTCTTTGCCGACTTGGAGAGT
ATTCTGATAGAGGTTTATATTGCAAACCATGCTCGTTTCCTTGTGAGACTTGTGAAGATT
ATGATGACAAATGCTTAAGTTGTGTTTAAGATTACACTTACAGCAATTATCAATGTTTAA
AAAATTCTAAAACTAATTTAAGATATTGTCATGAATCTTGTAATTCTTGTATTAGAGCAA
TGGATCCTAATTCATGTGATTCTTGTAAAGAAGGATACATTTTAATAAATAGAACTTGCC
AAAAGAAGAAAGGAAATTATTTTGAACCAAAAAATTGA