Identifiers and Description

Gene Model Identifier

TTHERM_00541520

Standard Name

LSF5 (Fusion of leishmanolysin-like peptidase and subtilisin-like proprotein convertase)

Aliases

PreTt14998 | 71.m00125 | 3729.m00007

Description

LSF5 leishmanolysin family protein; Fusion of leishmanolysin-like peptidase and subtilisin-like proprotein convertase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF04942 ) CC domain
  • ( PF03107 ) DC1 domain
  • ( PF08117 ) Ptu family
  • ( PF09146 ) BmKK2 toxic
  • ( PF01457 ) Leishmanolysin
  • ( PF00008 ) EGF-like domain
  • ( PF07974 ) EGF-like domain
  • ( PF08095 ) Hefutoxin family
  • ( PF02822 ) Antistasin family
  • ( PF00451 ) Scorpion short toxin
  • ( PF01754 ) A20-like zinc finger
  • ( PF09257 ) BCMA, TALL-1 binding
  • ( PF03940 ) Male specific sperm protein
  • ( PF00020 ) TNFR/NGFR cysteine-rich region
  • ( PF00757 ) Furin-like cysteine rich region
  • ( PF03860 ) Domain of Unknown Function (DUF326)
  • ( PF00053 ) Laminin EGF-like (Domains III and
  • ( PF07562 ) Nine Cysteines Domain of family
  • ( PF03302 ) Giardia variant-specific surface protein
  • ( PF01826 ) Trypsin Inhibitor like cysteine rich
  • ( PF00220 ) Neurohypophysial hormones, N-terminal Domain
  • ( PF00228 ) Bowman-Birk serine protease inhibitor family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 17.6%

TetraMine Data

TTHERM_00541520

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17014.19.997093137033517e-262leishmanolysin family protein
(1343 aa)
Stentor CoeruleusSteCoe_243101.6458114310822737e-38
OxytrichaContig169.0.g122.998577119979921e-31Tubulin-tyrosine ligase family
DictyBaseDDB_G02823056.9997332827772725e-22DDB_G0282305 on chromosome: 3
position 5613858 to 5616404
WormBaseWBGene000127961.000361553249356e-16Leishmanolysin-like peptidase
status:Partially_confirmed
UniProt:O62446 protein_id:C
AB16471.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00541520(coding)
ATGTACATTAGTTTTAGACCCAAAAGCTTGTATAAGATGTGCTTTTAATCATGTGATATG
ATAATCACTATATATAATTTGTAAATTTATATAAGTGTGAATTTATCTATAAAAGCACAT
TTTATGGACAACTTAATTTATCTAATTTTATATTAACATAAAAAAGTGTAAAATCTAAGA
AAAAAAAAAATGAAGAAATTTGCTAATTTACTGCTGCTTACTATTTTGATAGTAAATGCT
CACAGTAACGAATAATCAGTGGGTACTTATTCCTGTTTATAAGATGAAATAGATTTAAGT
GAAATAGTTCCCAAGGACTATCTAGAAACTTTTGATGAAAAGTATGGGCACAGAAAACTA
TAATAATAAGAACCTTAACCTATTAGAATTACTATAGACTTCAAAGAGTTTGATAATCCT
TTGAATGGAGATGGAATGACTCCTAACATAAAGGAATATTTAAAAAAAATTATGTATGCT
GCTCAGATTTATTTATCTAAACTAATTAAGGTTTACCCAAGATAAAAACCTATTAAGGTT
AATTACAATTAAGAATCATGTCACGATATAAAACTACCTGAAAATATAAGAACTGTAGGT
ATTGAAAATTCTGATCTACATATTTATGTCTCATACTCTAATTAACCCAACACCTCATTT
TTGGCTAATGCAATATGGTGTTAACTTGATCCTAACCCTACTATCGGAAGGGTTTTATTT
AATATCGGCAAAATGAATATTGATGAATCATCCACTTAATCTTTCTAAGATAACTTTTCA
ACCTCTTTACATGAAATTCTCCATGTACTAGGTTTTTCTAGTAATAGTATCTAATATTGG
ATTGATCCTGATACTAATAAACCATATGGGGTATCAAATGTTAATAAAGTGTTGAAAAGA
GAGACAAGATGGGAAATAAATAATGTTGTTAAAGTATCCTCTAAAAATATTTTAAAACTG
TCAAGAAACTACTATGGCTGTCCTTCAATTGATGGAATGTATCTTGAAAATTAAGGTGGT
GCTGGTTCTATGGGTTCTCACTTTGAAAGAGATTTACTTTCTAATGAATTCATGACTGCT
AGTATAGTTTATCGTACCTATACTATGTCCGAATTTACTGCTGCTTTACTTCTTGATACT
GGATTCTATGCTGAAATAAATTCTAATTTTCTCAATCCTATATATTGGGGTAAAAATAAA
GGATGTGATTTTTTCAATAAGACATGTTAAGCTGGTAAAGACTTCCCAGAATTCCCAGAT
AATTCTGTTTAAGAATCTTGTGATTTTTATTCTGAAGGTATTGGAAGTCCATAAAATTAT
GATTTTTATTCATAATGTAAAACCATATATACATTTAGCAACAGCTTTTGTTCTTCAGAG
GAATTTAAGCCTAATGAAGAGTTAAGATAAAATACTGGTAAAGGATCCAGATGTTTTAGA
TCAAATGCAAATGTCAGGGGTTATGAAGTGTTAGATATGAAAGGAAGATGCTTTAAAGCT
TAATGTGCAAGCGATATATCATCTATTAAAGTTAATGTTTGGGGTGATGAATATGTTACT
TGTAAATATCCTAATCAAGTTATTAACTTAGCTGAATAAACTAAAACTACTTAAGGTACA
ATGAAATGTCCTCATGATTTTGACTTATTTTGCAATTTCCCTAAGTCTTGTCCAAATAAT
TGCTCTAATAGTGGTGTGTGTAATAATGGTTATTGTGTTTGCCTCAAAGGATATGCTGGA
GCTGATTGCTCTTAAAGATGTCCTGATGAATATGTCTGGGATGGCAATAGATGTGTTTAA
AATTGTCCACGTGGATAGTTTAAAAACTTCGATAATACATGTAAACCTACTTGTCCTTAT
AAATATTATGGAGATTAATAAACAGGTAACTGTACTTTGTGCTCAGTAAACTGCTCAGCT
TGCTTTGGTTCAGCTTCTAATTAATGTCTTTCTTGTAATGATGGCTATTCCCTTTAAGGA
AATAAATGCGTTGAAAAGACTTGTCATTCAAGTTGTCAATCTTGCTCAGGACCTAATTCA
AACTAATGTACTTCATGCCCTGATGGAAAGTATTTAGATTCTAGAAATACATGTCAATAC
TGTTAATCGCCATGTGAAAACTGTTTCAACTCAGCTACTGAATGCACCACTTGCAGTTAG
GGATACTTTATGGATAGATTTAGCGGAAAATGTGTTTCTTAAAATTCTTGTGATAGTTCT
TGTCTTGACTGCTCTGCTTTTAGAGATCCTACAAAATGCACTTCTTGTAGAGATGGGTTT
TTTGTTAATAATGAAGGAAGATGCTAAAAATGTGATGAATCTTGCTCTACTTGTTCTTAA
AAAGCTGATAGCTGTATTAAATGTGCTTAAGGATGGGAATATAATGCTGAATATAAAAGG
TGTTTGATGAATTGCCATGAAAGTTGTAGTGGGTGCACTATAGCTTATGATTCAAAGGCT
TGTAAAAGATGTGCTTTTAATTATGTAATGTTAAATAATTTGTGCGTTCCTTGCGATAAA
AATTGCTATGGATGTAGTGGTGATATCAGAAAATGTACAGATTGTGTAAGAGGATATAAG
TTAGATCAAAGAACTAGCTAATGTGTTCCTGCTTGCAATTTAAATGAATTCTAAGATAGA
AATGGTAATTGCTAAAAATGTTAATCCCCATGTGCAACTTGTAAAAATTATCAAGATTAT
TGTTAAAGTTGTATAGCTGGTTATGCTTATGATGAATAATATAAAACTTGTAATCCTATG
AAGTATGCCTGCCATGATAGCTGTGGTGAATGTAGCAGATTTGATGATCCTAATGCATGT
ATTACTTGCAAAAGTGGAATGTATTTACAATCTGGAAGATGCTACTAATGTAGTGATAAA
TGCTAAACTTGTGAAAGGGAAGCTGATATTTGTACATCTTGCGAAAGGAAATAATTCTTA
CAAAACAAGTAATGTCTATAATGTCACCCTTCATGTTTAACTTGTTCAGGAATCGCAACT
AACTGTACTACTTGCAATGAAGGATTTTCAGTAGATCCTAAAACAGGCCTTTGCGTAGAT
AGTAAACCAACTTGTAATAGTGATGAGTATTTGGACAGAAACTTTTAATGTTAGAAATGC
ACAAATCCTTGTGCTTCTTGCTTTTACTACCCAAACAGATGTTCTAGCTGCGTTTCTGGT
TATAAATTGAATTAAAAAACTCTGTAGTGTGAGTTTGATTATGTAACTTGTAATGATGGT
TAATACTTAGCTGAAAATAATCAATGTAAACCTTGCGATTCTTCTTGTGCCACATGTGAA
TATTAGAGTACAAGATGTACCAGCTGTAAAAATGGTTTCACACTCTAAAGAAATTCATGC
TAATCATAAAAATGTCAAGATGGATCTTTCAGAAATGGATAAGGTCAATGTTAGAGATGT
GATGAATCTTGCTCTAAATGTGTAAACTTTTAAGATAATTGTACTGAATGTAATAATGGA
TATGTTTTTGATTAAAAAACCTAAAGATGTATTAAAAACTAAACAAGTTAATAATGTCAT
CCTTCTTGCAAAGAATGCAGCCAAGCAAATAATTCTTAAGCTTGTAAATCTTGTTTTGAT
GGTTTTTACATAAATAATAGAGGATAATGTCTTCAGTGTGAAAATTCTTGTTTGACTTGT
AACAGATTTTCAAACTTTTGTACTTCTTGTTAATAAGATTTCTAATTAGATAAAAATTAT
GGTAGGTGTATTCCTGTTTGCAAATCAGGTCAATACCTAGACTAATAAAGCAATCAATGC
AAAGATTGTGCATCTCCATGTGAAACTTGCTAATTTTATCCTACTTAATGCACTAGTTGT
ATTTCAGGATATAAACACAATTAAGTTTCTTACACCTGTGATATTTTTTGTTCATCTGGA
TAATATATTGATAGAGGTTAATAATGCAAACCCTGCTCATCTCCATGTGCTACTTGTGAA
TTCTATGATAATAGATGTTTGACATGTGTTTCTGGCTACACTTTAAACAATTTTATGTGC
CAAAAAAATTCTAACTCTAACCTCAGAAGTTGTCACGAATCTTGCAATACATGCACAAAA
GCCATGGATCCTCGTTCATGTGATTCTTGTAGAGAAGGATACGTCCTAGCGAATGGGTCT
TGTTAAAAAAAGAAAAAATGA


>TTHERM_00541520(protein)
MYISFRPKSLYKMCFQSCDMIITIYNLQIYISVNLSIKAHFMDNLIYLILYQHKKVQNLR
KKKMKKFANLLLLTILIVNAHSNEQSVGTYSCLQDEIDLSEIVPKDYLETFDEKYGHRKL
QQQEPQPIRITIDFKEFDNPLNGDGMTPNIKEYLKKIMYAAQIYLSKLIKVYPRQKPIKV
NYNQESCHDIKLPENIRTVGIENSDLHIYVSYSNQPNTSFLANAIWCQLDPNPTIGRVLF
NIGKMNIDESSTQSFQDNFSTSLHEILHVLGFSSNSIQYWIDPDTNKPYGVSNVNKVLKR
ETRWEINNVVKVSSKNILKLSRNYYGCPSIDGMYLENQGGAGSMGSHFERDLLSNEFMTA
SIVYRTYTMSEFTAALLLDTGFYAEINSNFLNPIYWGKNKGCDFFNKTCQAGKDFPEFPD
NSVQESCDFYSEGIGSPQNYDFYSQCKTIYTFSNSFCSSEEFKPNEELRQNTGKGSRCFR
SNANVRGYEVLDMKGRCFKAQCASDISSIKVNVWGDEYVTCKYPNQVINLAEQTKTTQGT
MKCPHDFDLFCNFPKSCPNNCSNSGVCNNGYCVCLKGYAGADCSQRCPDEYVWDGNRCVQ
NCPRGQFKNFDNTCKPTCPYKYYGDQQTGNCTLCSVNCSACFGSASNQCLSCNDGYSLQG
NKCVEKTCHSSCQSCSGPNSNQCTSCPDGKYLDSRNTCQYCQSPCENCFNSATECTTCSQ
GYFMDRFSGKCVSQNSCDSSCLDCSAFRDPTKCTSCRDGFFVNNEGRCQKCDESCSTCSQ
KADSCIKCAQGWEYNAEYKRCLMNCHESCSGCTIAYDSKACKRCAFNYVMLNNLCVPCDK
NCYGCSGDIRKCTDCVRGYKLDQRTSQCVPACNLNEFQDRNGNCQKCQSPCATCKNYQDY
CQSCIAGYAYDEQYKTCNPMKYACHDSCGECSRFDDPNACITCKSGMYLQSGRCYQCSDK
CQTCEREADICTSCERKQFLQNKQCLQCHPSCLTCSGIATNCTTCNEGFSVDPKTGLCVD
SKPTCNSDEYLDRNFQCQKCTNPCASCFYYPNRCSSCVSGYKLNQKTLQCEFDYVTCNDG
QYLAENNQCKPCDSSCATCEYQSTRCTSCKNGFTLQRNSCQSQKCQDGSFRNGQGQCQRC
DESCSKCVNFQDNCTECNNGYVFDQKTQRCIKNQTSQQCHPSCKECSQANNSQACKSCFD
GFYINNRGQCLQCENSCLTCNRFSNFCTSCQQDFQLDKNYGRCIPVCKSGQYLDQQSNQC
KDCASPCETCQFYPTQCTSCISGYKHNQVSYTCDIFCSSGQYIDRGQQCKPCSSPCATCE
FYDNRCLTCVSGYTLNNFMCQKNSNSNLRSCHESCNTCTKAMDPRSCDSCREGYVLANGS
CQKKKK


>TTHERM_00541520(gene)
ATGTACATTAGTTTTAGACCCAAAAGCTTGTATAAGATGTGCTTTTAATCATGTGATGTC
AAATAATTAATGCGTTCCTTGTGATAAAAGCTGCCATGGTTGTACAGAAAATCCTAAAAA
ATGCAACGAATGCGCAAAAGGATACTATTTAGATTCATATTATGATATATGTGTACCTAC
ATGTAGATCAGATGAGTTCCAAGATTCAAAAGGGAACTGCTAAAAATGTTAATAACCATG
TGCTACTTGCCAATTTTACAGTGATAATTGCATTACCTGCTTATCAGGTTATATTTATGA
TTTTTATTATAAATCTTGCATTCCTACAAATAGTTTTTGTCATGAAACCTGTGATTAATG
TAGTAGAAATAATGATCCCTACTCATGCACTAAATGTAAAGATGGGATGTATTTGATAAA
TGGTGAATGCTATTAATGTAGCGGTAAATGTTAAACTTGTGAAAAAAATGCTTTTTAATG
TACTTCTTGCAAATAGAAATAATTTTTAAACAACTATGAATGTCTTTAATGTCACAGTTC
TTGCTAAACATGTTTTGGAATTTCAACAAATTGCACTTCTTGCTAATAAGGTTTCTCAAA
AGATCCTTTGACAGGTCTTTGCATAAATAATTTACCTAGATGTAAAAGTAACGAATATTT
GGATAAAGATTATCAATGTTAATAATGTGAATTACCTTGCGCTTCTTGCTTCAATTTACC
AAATAAATGTTAAAGCTGTATTTCTGGTTATATTTACAATTCTTAAACATTTTAGTGTTA
ATAATTTAATCCGGTTTGTTATGAAGGAGAATTCTTGGATTTTGATAATAAATGTAAATA
TTGTGATCGAATTTGTGCCACTTGTGATATATACAGTAATAGATGCACAAGTTGTAAACA
TGGCTTTACTCTTTCAAAAAATTCTTGTTATGAAGATAAATGCTAAGATGGATCATTCAT
TAATTAGTATGGAAGATGTTAAAAATGTAGCAATTCATGTAGAAAATGTATAAATTATTA
TGATAACTGCACTGAATGTGCTGATGGATATTCTTATAATATAAGAACATAGACATGTGT
TATAAATGAAAGCTATTAAAAATGTCATCATACTTGTAAATAATGCAATTAAAGTAATAA
TGCATTTGCTTGCTAATCATGTTATGATTGTAACTATTTAAGCAATGGATAATGCCTTCC
ATGCAAAAATAATTGTTAGACTTGTGACAGATATTCTGATTTTTGCACTTCGTGTTAAAA
TGGATTTAAATTAAACAGAAATTAAGGTAGATGTATCCCAGAATGTAAGTATGGTGAATA
CTTAGACTAGAGTGTTAATTTATGTAAACAATGTGCATATCCTTGTGAGAGCTGTGAATT
TAATCCAAGTTAGTGTACTAGCTGTATTTAAGGATATAATTATAACAGTAAAAGTTAAAG
CTGTACCATTCTTTGCCGACTTGGAGAGTATTCTGATAGAGGTTTATATTGCAAACCATG
CTCGTTTCCTTGTGAGACTTGTGAAGATTATGATGACAAATGCTTAAGTTGTGTTTAAGA
TTACACTTACAGCAATTATCAATGTTTAAAAAATTCTAAAACTAATTTAAGATATTGTCA
TGAATCTTGTAATTCTTGTATTAGAGCAATGGATCCTAATTCATGTGATTCTTGTAAAGA
AGGATACATTTTAATAAATAGAACTTGCCAAAAGAAGAAAGGAAATTATTTTGAACCAAA
AAATTGATTATAATTTATTGTTGAATGTTTGTTAAAATAATCTATCTATATCTTTTATTT
GAAATTTTTTTTCTTCAATTTTTTAGGAAAAGTTTTTTCATATTTATAATGCAAATCTTC
ATTCTTTAATTAATAGTTTAATTCATATAAAACTTTTTTTTATTGTATCTAAAAAAAAAG
AATTATGATTTCAAAATTTTTATAAAATTGATTTAAAAAAAAAAATAATATTATATTAAT
TTTAATTTTATGTAAAAGATTAAAGCACAAAAAATTAATTTTAATCTCATCTTTAATCTA
TTTAATGTTATTTAATTTAGTAAATTTTAATATTTTATTGAAAAATGTCAAGTTTTAATA
TGTTTTTTGTTAAATAAATTAACTTTTAGTAATAATTATTAAAATCATTTTTAAAGGAAA
ATACATTTTATTGATAAATAATGTTCAAAAGAATTTTTACTATTCCTTTTAATATTTGAA
TTACTAAAATTCTAAAATAAGAGTTTCTTAAATAAATAAATAAAATCTTAAATCTTACTA
AAAGCATAAAAATTGGGATCTGTAAAGCTTTAATTTAATTAGCATAAAATTAATTTTTTT
CCATAAAAACTAAAATAATAAATAGATGGTACACCCTTATTTTTTTGTAATACCTACTTA
GATTTTATACTGTGGTTGAATAGTTAATTACTTAGTTATAAAGGTTGAAAGATAGTTTGA
AGTAATTAAATAAGGTTGGTACTTCCTTATTAAGATTTATTGATAAATTCTACCAAAAAA
AATAAGTATAACTAAATTTTGTAATAATGAAAAGAAAATATCAGTATTTAATAAAAAGTA
AAACACATAGATAATTAAGAGTAAGTGAAGTTATAATTTTTAAATTATATAGTTGAAATT
ATTTTAGTTTTGGCAAAACTGATTTATTTTCATTCGAGTTCTATAAATGTTTATTATCAG
TAATAAATTTTTATTTTCTTACCCTAAAATATAGATTAAATAGAGTCTAATTTATAGTAG
AAATCTAAATCTTTTTTAAAATTATATTTAAAAATGACATCTATCTTTACATTTTTTATG
TTATTCTAAATTTAAATAAATTCTTTAACTAGATGCTAAATACTAAGCTAATAAATATTA
CTTTCATACCTTTCGTTTTTATTATTTATTCTAAGTATATTTATTTATTAAATGCTTATT
TGCATTAGTTAAGCTATAAAAATTATGTTTTAGAGTCTAGTCTATAAATCTTACTTAATT
CATCCTTTTGATCTACTTAATACTTACAATATTTTGTAGATCAAATTAAAAGGGTATAAA
TCAAAAATCTTTCTTTTGATAGTATTTATTTAATTTTGCTCATATTTGTATTTTAATTAG
TATGATACATTTTATTAGTTTCTTTAAGTCCAGTAAAAATCAAATCATTAATTAATATAA
TAATAAATGTATAAGTGATTTTTGAAAACATATTAAATCTATTGATTATTAAAAATAATT
TTTTCAAATTACTTAAAAGGCATATTTTAAAACTAAATTAACAACCTGAATTTATGCTTT
TCAGAAATATTTTATTTTGAAAGATTTGTTACATAGTGTATGTATATGTGTATAATTTTT
ATTTTCACCTATTCAAAAATTTTAGTAATAGTTAGATTAAATTAAATTATCCAGTAATTT
ATTTTTGGTGTTTTGCTTTGCTTGAAAATAGATGATAATCACTATATATAATTTGTAAAT
TTATATAAGTGTGAATTTATCTATAAAAGCACATTTTATGGACAACTTAATTTATCTAAT
TTTATATTAACATAAAAAAGTGTAAAATCTAAGAAAAAAAAAAATGAAGAAATTTGCTAA
TTTACTGCTGCTTACTATTTTGATAGTAAATGCTCACAGTAACGAATAATCAGTGGGTAC
TTATTCCTGTTTATAAGATGAAATAGATTTAAGTGAAATAGTTCCCAAGGACTATCTAGA
AACTTTTGATGAAAAGTATGGGCACAGAAAACTATAATAATAAGAACCTTAACCTATTAG
AATTACTATAGACTTCAAAGAGTTTGATAATCCTTTGAATGGAGATGGAATGACTCCTAA
CATAAAGGAATATTTAAAAAAAATTATGTATGCTGCTCAGATTTATTTATCTAAACTAAT
TAAGGTTTACCCAAGATAAAAACCTATTAAGGTTAATTACAATTAAGAATCATGTCACGA
TATAAAACTACCTGAAAATATAAGAACTGTAGGTATTGAAAATTCTGATCTACATATTTA
TGTCTCATACTCTAATTAACCCAACACCTCATTTTTGGCTAATGCAAGTAAGTATTATTA
TATCATTAAATTTATAAATTTAATAAAATTATTTATTATTAAAAAAGTATGGTGTTAACT
TGATCCTAACCCTACTATCGGAAGGGTTTTATTTAATATCGGCAAAATGAATATTGATGA
ATCATCCACTTAATCTTTCTAAGATAACTTTTCAACCTCTTTACATGAAATTCTCCATGT
ACTAGGTTTTTCTAGTAATAGTATCTAATATTGGATTGATCCTGATACTAATAAACCATA
TGGGGTATCAAATGTTAATAAAGTGTTGAAAAGAGAGACAAGATGGGAAATAAATAATGT
TGTTAAAGTATCCTCTAAAAATATTTTAAAACTGTCAAGAAACTACTATGGCTGTCCTTC
AATTGATGGAATGTATCTTGAAAATTAAGGTGGTGCTGGTTCTATGGGTTCTCACTTTGA
AAGAGATTTACTTTCTAATGAATTCATGACTGCTAGTATAGTTTATCGTACCTATACTAT
GTCCGAATTTACTGCTGCTTTACTTCTTGATACTGGATTCTATGCTGAAATAAATTCTAA
TTTTCTCAATCCTATATATTGGGGTAAAAATAAAGGATGTGATTTTTTCAATAAGACATG
TTAAGCTGGTAAAGACTTCCCAGAATTCCCAGATAATTCTGTTTAAGAATCTTGTGATTT
TTATTCTGAAGGTATTGGAAGTCCATAAAATTATGATTTTTATTCATAATGTAAAACCAT
ATATACATTTAGCAACAGCTTTTGTTCTTCAGAGGAATTTAAGCCTAATGAAGAGTTAAG
ATAAAATACTGGTAAAGGATCCAGATGTTTTAGATCAAATGCAAATGTCAGGGGTTATGA
AGTGTTAGATATGAAAGGAAGATGCTTTAAAGCTTAATGTGCAAGCGATATATCATCTAT
TAAAGTTAATGTTTGGGGTGATGAATATGTTACTTGTAAATATCCTAATCAAGTTATTAA
CTTAGCTGAATAAACTAAAACTACTTAAGGTACAATGAAATGTCCTCATGATTTTGACTT
ATTTTGCAATTTCCCTAAGTCTTGTCCAAATAATTGCTCTAATAGTGGTGTGTGTAATAA
TGGTTATTGTGTTTGCCTCAAAGGATATGCTGGAGCTGATTGCTCTTAAAGATGTCCTGA
TGAATATGTCTGGGATGGCAATAGATGTGTTTAAAATTGTCCACGTGGATAGTTTAAAAA
CTTCGATAATACATGTAAACCTACTTGTCCTTATAAATATTATGGAGATTAATAAACAGG
TAACTGTACTTTGTGCTCAGTAAACTGCTCAGCTTGCTTTGGTTCAGCTTCTAATTAATG
TCTTTCTTGTAATGATGGCTATTCCCTTTAAGGAAATAAATGCGTTGAAAAGACTTGTCA
TTCAAGTTGTCAATCTTGCTCAGGACCTAATTCAAACTAATGTACTTCATGCCCTGATGG
AAAGTATTTAGATTCTAGAAATACATGTCAATACTGTTAATCGCCATGTGAAAACTGTTT
CAACTCAGCTACTGAATGCACCACTTGCAGTTAGGGATACTTTATGGATAGATTTAGCGG
AAAATGTGTTTCTTAAAATTCTTGTGATAGTTCTTGTCTTGACTGCTCTGCTTTTAGAGA
TCCTACAAAATGCACTTCTTGTAGAGATGGGTTTTTTGTTAATAATGAAGGAAGATGCTA
AAAATGTGATGAATCTTGCTCTACTTGTTCTTAAAAAGCTGATAGCTGTATTAAATGTGC
TTAAGGATGGGAATATAATGCTGAATATAAAAGGTGTTTGATGAATTGCCATGAAAGTTG
TAGTGGGTGCACTATAGCTTATGATTCAAAGGCTTGTAAAAGATGTGCTTTTAATTATGT
AATGTTAAATAATTTGTGCGTTCCTTGCGATAAAAATTGCTATGGATGTAGTGGTGATAT
CAGAAAATGTACAGATTGTGTAAGAGGATATAAGTTAGATCAAAGAACTAGCTAATGTGT
TCCTGCTTGCAATTTAAATGAATTCTAAGATAGAAATGGTAATTGCTAAAAATGTTAATC
CCCATGTGCAACTTGTAAAAATTATCAAGATTATTGTTAAAGTTGTATAGCTGGTTATGC
TTATGATGAATAATATAAAACTTGTAATCCTATGAAGTATGCCTGCCATGATAGCTGTGG
TGAATGTAGCAGATTTGATGATCCTAATGCATGTATTACTTGCAAAAGTGGAATGTATTT
ACAATCTGGAAGATGCTACTAATGTAGTGATAAATGCTAAACTTGTGAAAGGGAAGCTGA
TATTTGTACATCTTGCGAAAGGAAATAATTCTTACAAAACAAGTAATGTCTATAATGTCA
CCCTTCATGTTTAACTTGTTCAGGAATCGCAACTAACTGTACTACTTGCAATGAAGGATT
TTCAGTAGATCCTAAAACAGGCCTTTGCGTAGATAGTAAACCAACTTGTAATAGTGATGA
GTATTTGGACAGAAACTTTTAATGTTAGAAATGCACAAATCCTTGTGCTTCTTGCTTTTA
CTACCCAAACAGATGTTCTAGCTGCGTTTCTGGTTATAAATTGAATTAAAAAACTCTGTA
GTGTGAGTTTGATTATGTAACTTGTAATGATGGTTAATACTTAGCTGAAAATAATCAATG
TAAACCTTGCGATTCTTCTTGTGCCACATGTGAATATTAGAGTACAAGATGTACCAGCTG
TAAAAATGGTTTCACACTCTAAAGAAATTCATGCTAATCATAAAAATGTCAAGATGGATC
TTTCAGAAATGGATAAGGTCAATGTTAGAGATGTGATGAATCTTGCTCTAAATGTGTAAA
CTTTTAAGATAATTGTACTGAATGTAATAATGGATATGTTTTTGATTAAAAAACCTAAAG
ATGTATTAAAAACTAAACAAGTTAATAATGTCATCCTTCTTGCAAAGAATGCAGCCAAGC
AAATAATTCTTAAGCTTGTAAATCTTGTTTTGATGGTTTTTACATAAATAATAGAGGATA
ATGTCTTCAGTGTGAAAATTCTTGTTTGACTTGTAACAGATTTTCAAACTTTTGTACTTC
TTGTTAATAAGATTTCTAATTAGATAAAAATTATGGTAGGTGTATTCCTGTTTGCAAATC
AGGTCAATACCTAGACTAATAAAGCAATCAATGCAAAGATTGTGCATCTCCATGTGAAAC
TTGCTAATTTTATCCTACTTAATGCACTAGTTGTATTTCAGGATATAAACACAATTAAGT
TTCTTACACCTGTGATATTTTTTGTTCATCTGGATAATATATTGATAGAGGTTAATAATG
CAAACCCTGCTCATCTCCATGTGCTACTTGTGAATTCTATGATAATAGATGTTTGACATG
TGTTTCTGGCTACACTTTAAACAATTTTATGTGCCAAAAAAATTCTAACTCTAACCTCAG
AAGTTGTCACGAATCTTGCAATACATGCACAAAAGCCATGGATCCTCGTTCATGTGATTC
TTGTAGAGAAGGATACGTCCTAGCGAATGGGTCTTGTTAAAAAAAGAAAAAATGA