Identifiers and Description

Gene Model Identifier

TTHERM_01082860

Standard Name

LSF4 (Fusion of leishmanolysin-like peptidase and subtilisin-like proprotein convertase)

Aliases

PreTt17860 | 224.m00030

Description

Fusion of leishmanolysin-like peptidase and subtilisin-like proprotein convertase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01082860

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17014.19.997093137033517e-262leishmanolysin family protein
(1343 aa)
Stentor CoeruleusSteCoe_243104.906094730649281e-35
OxytrichaContig18862.0.g773.998693556225637e-29hypothetical protein
DictyBaseDDB_G02933648.00344477495519e-22sigB on chromosome: 6 position
2822106 to 2824254
WormBaseWBGene000127969.99946582325553e-18Leishmanolysin-like peptidase
status:Partially_confirmed
UniProt:O62446 protein_id:C
AB16471.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01082860(coding)
ATGAATAAAATTACGATTCTAATTTTACTAACAATTTCATTAGTAAATACTCAATAAGAG
GACTAATTGCCTGTGAACACTTATTTGGATGACGAAATTGACATTGATGAAATACTTCCT
AAGGACTACTTTGAAACTTTTGAAGAAAAATATGGACACAGAAAACTATAGAATTTAGAA
CCTTAGCCTATTAGAATTACACTAGATTTCGAAGAACTTGATAATCCTTAGAATGGAGAT
GGAGTAACGCCAAATATAAAAGAATACATATAAAAAATTATGTATGCTGCTCAAACATAT
TTGAATAAACTCATTAAAGTATATCCTAGATAAAAGCCTAACAAACATGCTTGGAATAGT
GATAAATGCTACGATGTTAAATTGAATAACTAAATAAAAACAGTTGGTATTGATAACTCT
GACTTGCATATCATCGTCACCTACTAAAATTAAAAAAATATCACTTAATTAGCTAATGCA
ATTTGGTGCTCATTAGATCCATAGCCTAATATTGGAAGAGTCAAGTTCAATATTGGTACA
ATGGACATTAATGAATCCTCTACTTAATCTTTCTAGAATAACTTCTCTACGGCTTTGCAT
GAAATTCTCCATATTTTAGGTTTCTCATAAGGTGGGTTCCATTGCTGGATTGATCCTGAC
ACAGGCAGCCCTTATGGATGGTAAAACAAATTCAAGATGCACAAAATAGAAAGAAGATGG
TAAACAGATAATGTAACTAAGATATTTACCAAAAATTTATTGAAAACTGCTAGAAACTAT
TATAACTGTCCTTCTATTGATGGTATGTATCTTGAAAACTAAGGTGGATCTGGTTCTAAG
GGTTCTCACTGGGAAAGAGATTTAGTTAATAATGAATTTATGACAGCTAGTATTGTTTAT
AATACATATACTATTTCAGAATTCACTGCTGCGCTACTTTTAGATACAGGTTTTTATGCT
GAAATCAATACTAATCTACTCATGCCTATTTATTGGGGTAAGAATAAAGGATGTGATTTT
TTCAATAACTCCTGCAATACTGGAAAATATTTCCCTGAATTCCCAGATGATAGTGAAAAG
GAATCGTGCGATTTCTTTTCTTAAGGTATCGGTTAGCTCTAAAATTATGATTACTTCTCT
TAGTGCAAAACAATCTCTTCCTATTCAAACTCTCGCTGCTAATCAGATTCATTTAAACCT
AATGAAAAATTGAGATAAAATACAGGGGAAGGATCAAGATGCTTTAGATCAAATGCAAAC
ATCAAAGGACTTGACGTTTTAGATATGAATGGTAGATGCTTTAAGGCTTAATGTGCAGAT
GATTTATCCTCGATTAAAGTTAATATTTGGGGAGATGAGTATGTTACTTGCTAATATCCA
AATTAAGTCATTAATTTAGCAGATTAAACTAAAACTACATAAGGTACTATGAGATGTCCA
CATGATTTTGATTTATTTTGCAATTTCCCTAAATCGTGTCCTAATAATTGCTCTAATAAC
GGTGTCTGTAATAATGGCTACTGCATGTGTCTCAAAGGATATGCTGGTATTGATTGCTCT
AAAAGATGTGGTGAAGGCTAAGTTTGGGATGGTGCTCGCTGTGTATATAATTGCCCTTCT
GGATAATTCAAAAACTTTGACAATACTTGCAAATCGACTTGTCCTTACAAATAATATGGA
GATAAATCCACTGGTAATTGCACTCTATGTTCATCTAACTGCTCTTCCTGCTATGGCCCT
TCTCCTAATGAATGTCTTTCTTGCAAGGAAGGATATTCTCTTTAAAGAAACTAATGCGTT
GATCTTACTTGCCACCCTAGTTGCCAATAATGCTCTGGTCCTTATTCAAATCAGTGCACT
TCTTGCTCTGCTGGTTATTATTTGGACTCTAGAAAAACTTGCTAACCATGTTAACATCCT
TGTGAAAATTGTTATAACTCAGCTTCAGAGTGCACTTCTTGTGGAGAAGGATACGAAATG
GATAAGTTTAGCGGAAAATGTGTTTCAATTTATACATGTGATAGCTCTTGTCTTGAGTGC
TCAGCTTATAGAGACCCAACAAAATGTACATCTTGTAGGGATGGCTTTTTCCTCAATGAC
TATGGTAGATGCTAAAAATGTGATGAATCTTGCGCTACATGCTCTGAAAGAGAGAATAAA
TGTATAAAATGTAGTGATGGGTGGGAATACGATGCATATTATTAAAGATGTATTATGAAT
TGCCATAAAAGTTGTGATACATGTACAGTTCGTGATGATCCTACAGCTTGCAAAAGGTGT
GCTTTCAATTACATAATGTAAAATAAACTATGTGTTAAATGTGATAAAAGTTGCTATGGA
TGCAAAGATGACCCTAAAAAATGTCATTATTGTGCTGATGGATACAAATTTGACTCAAAT
AATTAAACTTGCATTCCAAAGTGCAGGACTGATGAATTTGAAGATAGAACTGGTAACTGC
TAAAAGTGCAAGTCTCCTTGCGCTACTTGCAAATATTATTAAGAACACTGTACTAGTTGC
TTAGCTGGTTATACATACAATCCTTAGTATAAATCTTGTTAGGTTACAAGAAACGCTTGT
CATGAAAGTTGTGCTTAATGTAATAGATATGATGATCCTAATTCTTGCACACTATGTAGT
AAAGGAAAGTATCTGTAGTCTGGAAGATGTTTATCCTGTAGTGATAAATGCTAATCTTGT
GAAGGAGATGCTAACGTTTGCACTTCTTGTAAAAAGAATGAGTTCCTGTAAAATAACGAA
TGCATCAAATGCCATAGCTCTTGTCTGACCTGCTCTGGAATTTCAACAAATTGCACTTCT
TGTGAAACTGGTTTCTCAAAAGATCCTATGACCGGTGTTTGTGTTGACAGCACACCTGTT
TGTAAAAGTGACGAATACTTGGACAGATATAATAAATGTTAAAAATGCTACTCACCATGT
TCATCTTGTTTCTTCTATCCTAACAGATGTACAAGTTGTATTTCTGGCTACAAATTCAAC
TCTTAAACATTTTCTTGCGAATACGATTATCCTACATGTAAAGATGGGTAATACTTAGAT
GCTAATAATAATTGCTAGCTTTGTGATTCATCATGTGCTACTTGCATTTAAACATCCACA
AGATGTAACAGTTGTAAATCTGGCTTTGTTCTTTCAAGATATACTTGCTTACCCTCTAGC
TGTTAAGATGGATTTTTCATGAATTAATAAGGGAGATGCTTATAATGTAGTGAATCTTGC
ACTAAATGTGTAAACAATTAAGATAATTGTATTGAATGTGCCAGAGGATACACTCTAGAT
AAAGCAACTTAAAAATGTATAAGAAGATAAAAGAAATAACAATGTCATCCTTCATGTAAG
AATTGTAGCTCACCTAATAATGATTCTGCCTGCTTATCATGCAAAGATGGTCATTATTTA
AATAACAGAAGTTAATGTCTTCAATGTGATAATTCTTGTTTAACGTGTGACAGGTATTCA
GATTATTGTACTTCATGCTAATAAGGTTTTAGTTTAGACAAAATTTAAGGTAAATGTATT
CCTACATGTAGAGCAGATTAGTTTTTAGATGTTTATGATAACTAATGCAAATCATGTGAA
CACCCTTGCTAAAGTTGCTAATATTATGCTAATAGTTGTCTTAGCTGTATATCTGGATAT
GAGTATGATAATTAAAGATAGAGCTGCTCAATTTCTTGCTAACCTGGATAGTATGTTGAT
CGTGATGAAAAGTGTTAACCCTGCTCTTCTCCATGTGCAACTTGCGAATACTATGATAAT
AGGTGTTTGAGCTGTGTCTCTGGTTATACTTATAACAATTTCTATTGTTAAAAGAGCTCT
AATAATAACTCCAGAGGCTGCCACCAATCCTGCAATACATGTACAAGAGCTATGGATCCT
CGTTCATGTGATTCTTGTAGAGAAGGATATAAGTTGGTGAATGGATCCTGTTTAAAAAAG
AGAGGAAACTACTCTGGACCTAATAATTGA


>TTHERM_01082860(protein)
MNKITILILLTISLVNTQQEDQLPVNTYLDDEIDIDEILPKDYFETFEEKYGHRKLQNLE
PQPIRITLDFEELDNPQNGDGVTPNIKEYIQKIMYAAQTYLNKLIKVYPRQKPNKHAWNS
DKCYDVKLNNQIKTVGIDNSDLHIIVTYQNQKNITQLANAIWCSLDPQPNIGRVKFNIGT
MDINESSTQSFQNNFSTALHEILHILGFSQGGFHCWIDPDTGSPYGWQNKFKMHKIERRW
QTDNVTKIFTKNLLKTARNYYNCPSIDGMYLENQGGSGSKGSHWERDLVNNEFMTASIVY
NTYTISEFTAALLLDTGFYAEINTNLLMPIYWGKNKGCDFFNNSCNTGKYFPEFPDDSEK
ESCDFFSQGIGQLQNYDYFSQCKTISSYSNSRCQSDSFKPNEKLRQNTGEGSRCFRSNAN
IKGLDVLDMNGRCFKAQCADDLSSIKVNIWGDEYVTCQYPNQVINLADQTKTTQGTMRCP
HDFDLFCNFPKSCPNNCSNNGVCNNGYCMCLKGYAGIDCSKRCGEGQVWDGARCVYNCPS
GQFKNFDNTCKSTCPYKQYGDKSTGNCTLCSSNCSSCYGPSPNECLSCKEGYSLQRNQCV
DLTCHPSCQQCSGPYSNQCTSCSAGYYLDSRKTCQPCQHPCENCYNSASECTSCGEGYEM
DKFSGKCVSIYTCDSSCLECSAYRDPTKCTSCRDGFFLNDYGRCQKCDESCATCSERENK
CIKCSDGWEYDAYYQRCIMNCHKSCDTCTVRDDPTACKRCAFNYIMQNKLCVKCDKSCYG
CKDDPKKCHYCADGYKFDSNNQTCIPKCRTDEFEDRTGNCQKCKSPCATCKYYQEHCTSC
LAGYTYNPQYKSCQVTRNACHESCAQCNRYDDPNSCTLCSKGKYLQSGRCLSCSDKCQSC
EGDANVCTSCKKNEFLQNNECIKCHSSCLTCSGISTNCTSCETGFSKDPMTGVCVDSTPV
CKSDEYLDRYNKCQKCYSPCSSCFFYPNRCTSCISGYKFNSQTFSCEYDYPTCKDGQYLD
ANNNCQLCDSSCATCIQTSTRCNSCKSGFVLSRYTCLPSSCQDGFFMNQQGRCLQCSESC
TKCVNNQDNCIECARGYTLDKATQKCIRRQKKQQCHPSCKNCSSPNNDSACLSCKDGHYL
NNRSQCLQCDNSCLTCDRYSDYCTSCQQGFSLDKIQGKCIPTCRADQFLDVYDNQCKSCE
HPCQSCQYYANSCLSCISGYEYDNQRQSCSISCQPGQYVDRDEKCQPCSSPCATCEYYDN
RCLSCVSGYTYNNFYCQKSSNNNSRGCHQSCNTCTRAMDPRSCDSCREGYKLVNGSCLKK
RGNYSGPNN


>TTHERM_01082860(gene)
ATGAATAAAATTACGATTCTAATTTTACTAACAATTTCATTAGTAAATACTCAATAAGAG
GACTAATTGCCTGTGAACACTTATTTGGATGACGAAATTGACATTGATGAAATACTTCCT
AAGGACTACTTTGAAACTTTTGAAGAAAAATATGGACACAGAAAACTATAGAATTTAGAA
CCTTAGCCTATTAGAATTACACTAGATTTCGAAGAACTTGATAATCCTTAGAATGGAGAT
GGAGTAACGCCAAATATAAAAGAATACATATAAAAAATTATGTATGCTGCTCAAACATAT
TTGAATAAACTCATTAAAGTATATCCTAGATAAAAGCCTAACAAACATGCTTGGAATAGT
GATAAATGCTACGATGTTAAATTGAATAACTAAATAAAAACAGTTGGTATTGATAACTCT
GACTTGCATATCATCGTCACCTACTAAAATTAAAAAAATATCACTTAATTAGCTAATGCA
AGTAAAAAAATTTAATTTTTTTTAATTATCATGTTTGTAAATATTTTTAACTATTTAATT
AGTTTGGTGCTCATTAGATCCATAGCCTAATATTGGAAGAGTCAAGTTCAATATTGGTAC
AATGGACATTAATGAATCCTCTACTTAATCTTTCTAGAATAACTTCTCTACGGCTTTGCA
TGAAATTCTCCATATTTTAGGTTTCTCATAAGGTGGGTTCCATTGCTGGATTGATCCTGA
CACAGGCAGCCCTTATGGATGGTAAAACAAATTCAAGATGCACAAAATAGAAAGAAGATG
GTAAACAGATAATGTAACTAAGATATTTACCAAAAATTTATTGAAAACTGCTAGAAACTA
TTATAACTGTCCTTCTATTGATGGTATGTATCTTGAAAACTAAGGTGGATCTGGTTCTAA
GGGTTCTCACTGGGAAAGAGATTTAGTTAATAATGAATTTATGACAGCTAGTATTGTTTA
TAATACATATACTATTTCAGAATTCACTGCTGCGCTACTTTTAGATACAGGTTTTTATGC
TGAAATCAATACTAATCTACTCATGCCTATTTATTGGGGTAAGAATAAAGGATGTGATTT
TTTCAATAACTCCTGCAATACTGGAAAATATTTCCCTGAATTCCCAGATGATAGTGAAAA
GGAATCGTGCGATTTCTTTTCTTAAGGTATCGGTTAGCTCTAAAATTATGATTACTTCTC
TTAGTGCAAAACAATCTCTTCCTATTCAAACTCTCGCTGCTAATCAGATTCATTTAAACC
TAATGAAAAATTGAGATAAAATACAGGGGAAGGATCAAGATGCTTTAGATCAAATGCAAA
CATCAAAGGACTTGACGTTTTAGATATGAATGGTAGATGCTTTAAGGCTTAATGTGCAGA
TGATTTATCCTCGATTAAAGTTAATATTTGGGGAGATGAGTATGTTACTTGCTAATATCC
AAATTAAGTCATTAATTTAGCAGATTAAACTAAAACTACATAAGGTACTATGAGATGTCC
ACATGATTTTGATTTATTTTGCAATTTCCCTAAATCGTGTCCTAATAATTGCTCTAATAA
CGGTGTCTGTAATAATGGCTACTGCATGTGTCTCAAAGGATATGCTGGTATTGATTGCTC
TAAAAGATGTGGTGAAGGCTAAGTTTGGGATGGTGCTCGCTGTGTATATAATTGCCCTTC
TGGATAATTCAAAAACTTTGACAATACTTGCAAATCGACTTGTCCTTACAAATAATATGG
AGATAAATCCACTGGTAATTGCACTCTATGTTCATCTAACTGCTCTTCCTGCTATGGCCC
TTCTCCTAATGAATGTCTTTCTTGCAAGGAAGGATATTCTCTTTAAAGAAACTAATGCGT
TGATCTTACTTGCCACCCTAGTTGCCAATAATGCTCTGGTCCTTATTCAAATCAGTGCAC
TTCTTGCTCTGCTGGTTATTATTTGGACTCTAGAAAAACTTGCTAACCATGTTAACATCC
TTGTGAAAATTGTTATAACTCAGCTTCAGAGTGCACTTCTTGTGGAGAAGGATACGAAAT
GGATAAGTTTAGCGGAAAATGTGTTTCAATTTATACATGTGATAGCTCTTGTCTTGAGTG
CTCAGCTTATAGAGACCCAACAAAATGTACATCTTGTAGGGATGGCTTTTTCCTCAATGA
CTATGGTAGATGCTAAAAATGTGATGAATCTTGCGCTACATGCTCTGAAAGAGAGAATAA
ATGTATAAAATGTAGTGATGGGTGGGAATACGATGCATATTATTAAAGATGTATTATGAA
TTGCCATAAAAGTTGTGATACATGTACAGTTCGTGATGATCCTACAGCTTGCAAAAGGTG
TGCTTTCAATTACATAATGTAAAATAAACTATGTGTTAAATGTGATAAAAGTTGCTATGG
ATGCAAAGATGACCCTAAAAAATGTCATTATTGTGCTGATGGATACAAATTTGACTCAAA
TAATTAAACTTGCATTCCAAAGTGCAGGACTGATGAATTTGAAGATAGAACTGGTAACTG
CTAAAAGTGCAAGTCTCCTTGCGCTACTTGCAAATATTATTAAGAACACTGTACTAGTTG
CTTAGCTGGTTATACATACAATCCTTAGTATAAATCTTGTTAGGTTACAAGAAACGCTTG
TCATGAAAGTTGTGCTTAATGTAATAGATATGATGATCCTAATTCTTGCACACTATGTAG
TAAAGGAAAGTATCTGTAGTCTGGAAGATGTTTATCCTGTAGTGATAAATGCTAATCTTG
TGAAGGAGATGCTAACGTTTGCACTTCTTGTAAAAAGAATGAGTTCCTGTAAAATAACGA
ATGCATCAAATGCCATAGCTCTTGTCTGACCTGCTCTGGAATTTCAACAAATTGCACTTC
TTGTGAAACTGGTTTCTCAAAAGATCCTATGACCGGTGTTTGTGTTGACAGCACACCTGT
TTGTAAAAGTGACGAATACTTGGACAGATATAATAAATGTTAAAAATGCTACTCACCATG
TTCATCTTGTTTCTTCTATCCTAACAGATGTACAAGTTGTATTTCTGGCTACAAATTCAA
CTCTTAAACATTTTCTTGCGAATACGATTATCCTACATGTAAAGATGGGTAATACTTAGA
TGCTAATAATAATTGCTAGCTTTGTGATTCATCATGTGCTACTTGCATTTAAACATCCAC
AAGATGTAACAGTTGTAAATCTGGCTTTGTTCTTTCAAGATATACTTGCTTACCCTCTAG
CTGTTAAGATGGATTTTTCATGAATTAATAAGGGAGATGCTTATAATGTAGTGAATCTTG
CACTAAATGTGTAAACAATTAAGATAATTGTATTGAATGTGCCAGAGGATACACTCTAGA
TAAAGCAACTTAAAAATGTATAAGAAGATAAAAGAAATAACAATGTCATCCTTCATGTAA
GAATTGTAGCTCACCTAATAATGATTCTGCCTGCTTATCATGCAAAGATGGTCATTATTT
AAATAACAGAAGTTAATGTCTTCAATGTGATAATTCTTGTTTAACGTGTGACAGGTATTC
AGATTATTGTACTTCATGCTAATAAGGTTTTAGTTTAGACAAAATTTAAGGTAAATGTAT
TCCTACATGTAGAGCAGATTAGTTTTTAGATGTTTATGATAACTAATGCAAATCATGTGA
ACACCCTTGCTAAAGTTGCTAATATTATGCTAATAGTTGTCTTAGCTGTATATCTGGATA
TGAGTATGATAATTAAAGATAGAGCTGCTCAATTTCTTGCTAACCTGGATAGTATGTTGA
TCGTGATGAAAAGTGTTAACCCTGCTCTTCTCCATGTGCAACTTGCGAATACTATGATAA
TAGGTGTTTGAGCTGTGTCTCTGGTTATACTTATAACAATTTCTATTGTTAAAAGAGCTC
TAATAATAACTCCAGAGGCTGCCACCAATCCTGCAATACATGTACAAGAGCTATGGATCC
TCGTTCATGTGATTCTTGTAGAGAAGGATATAAGTTGGTGAATGGATCCTGTTTAAAAAA
GAGAGGAAACTACTCTGGACCTAATAATTGA