Identifiers and Description

Gene Model Identifier

TTHERM_00543580

Standard Name

LSF11 (Fusion of leishmanolysin-like peptidase and subtilisin-like proprotein convertase)

Aliases

PreTt15006 | 71.m00133 | 3729.m00013

Description

Fusion of leishmanolysin-like peptidase and subtilisin-like proprotein convertase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 77.4%

TetraMine Data

TTHERM_00543580

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17014.19.997093137033517e-262leishmanolysin family protein
(1343 aa)
OxytrichaContig169.0.g129.995739965151785e-43Tubulin-tyrosine ligase family
Stentor CoeruleusSteCoe_318441.1089390193121365e-40
DictyBaseDDB_G02933649.997019043202629e-21sigB on chromosome: 6 position
2822106 to 2824254
WormBaseWBGene000127960.000000000000020000882446601127Leishmanolysin-like peptidase
status:Partially_confirmed
UniProt:O62446 protein_id:C
AB16471.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00543580(coding)
ATGAATAAAGTTACTTTATTGCTATTGTTAACAGCTTTATTAGTAAATTCACAATTTACT
GATAAAAAGGTTGTTAACTCTTGCTTACAAGACGAAATCGATATGAGTAAAATTGTTCCA
TAAGACTACTTAGAAACGTTTGATGAAAAATATGGATAAAGAAAGCTCCAAAGGTCTGAG
CCCTAACCTTTTAGAATTACACTTGATTTTAATGAATTAGACAATCCTCTAAATGGAGCT
GGAATGACTCCAAGTTTAAAAGAATACATTAAGAAAATTATGTATGCTGCTTAGACATTT
TTGAACAAGCTCATTAAGGTACATCCTAGATAAAAACCAAATAAATATACTTGGTTTAAT
CATCTTTGTTATGATACATTACTTTCTGAATAGATAAAAACAGTTGGTGTAGATAATTCT
GATTTACATATTTTTGTTACCTATGGTAATGAACGCGCTTCATATGTAGCAAATGCAATT
TGGTGTAACTTAGATCCTAATCCTAATGTTGGAAGAGTTAAATTCAATTTAGGAAATATG
TTTATAGATGAAACATCTGGTTAGTCTTTCTTGGATTACTTTTCAGTTGCCTTGCATGAA
ATTATGCATATCTTAGGTTTCTCAGGTAATAGTATTTAATATTGGATTGATCCTGATACA
GGTAGCGCTTATGGTTACTGGAGTGTTGAAAAAATATTGAAAAAAGAAAGAAGATGGGAT
ATTGAAAATGTAACAAAGATATCTTCTAAAAATCTTTTGAAAGTTTCCAGAAATCACTAT
AATTGTCCTTCAATTGATGGCATGTACCTTGAAAATTAAGGTGAAGGTGGCTCTTTTGGT
TCACATTGGGAAAGAGATTTACTTGGAAATGAATTTATGACTGCAAGTACGGTCTTTGGC
TACTATACTATATCTGAATTTACAGCTGCTCTCCTTTTAGATACTGGTTATTATGCTGAA
ATCAATCAAAATCTCCTTATGCCTCTTTACTGGGGTAAAAATAAAGGCTGTGACTTCTTC
AATAAATCATGCAACGCTGGAAAGTACTTTGCTGAATTCTCAGATGATACTACCAGAGAA
GGTTGTGATTTTTACTCTTATGGTATTGGTCGTCGCTATAAAACTGATCCATTCTCGTAA
TGTGAAAATATTGTAATCAGCATTTAAGGTAGATGTGATTCTGATGACTTTAAATCTGAA
AACTTTTTCAGATAAAACCCTGGTGCTGGCTCTAGATGTTTTAGATCAAATTCAAATGCC
AAAGGAGAAAACTTTTTGAATATTTAAGGCAGATGCTTTAAGGCATAATGTTCAAACGAT
TTATCATCAATTAAAGTTAATGTTTGGGAAAACGAATTTGTTACTTGCTAATACCCAAAT
TAAGTTATTAATTTGGCAGAATAAACTAAAACTACTTAAGGTGTTATGAAATGCCCTGAT
GATTTTGAATTGTTTTGTGGTTTCCCTAAATAATGCCCAAATAAATGTTCAAGTAATGGT
ATTTGTATTAATGGATTTTGTATTTGCTTAAAAGGATATGCTGGGGACGATTGCTCTAAA
AGATGTGGTGAGGATTAAGTTTGGGATGGCGCACACTGCACATTAAATTGCCCTTCTGGA
TTATTTAAGAATTTTGATAACACTTGCAAGACCACTTGTCCTTATAAGTAATATGGAGAT
TAAGCAACACGTAGTTGTGCTGTTTGCTCTAATAAATGTTCTGCATGTTTTGGTCCCTCT
TCTAATTAATGTATTTCTTGCAATAACGGTTTTATTCTTTAAGGAAATCAATGTATAGAA
GCTACTTGTCATTCAAGTTGTCAAACATGCTCAGGACCTAATGCCAATTAGTGCACTTCT
TGTCCATCTGGAACATATTTAGACTCAAGTAAGACTTGTCAACCTTGCTAGGCTCCATGT
GAAAGCTGTTTCAATTCAGCAACTGAATGCACAACTTGTGTTAAGGATTATGAAATTGAT
AAAGCAAGTGGGTAATGTATTTTTAGCAAGGTTTGTGATATTTCTTGTCAAGATTGTTAT
GTGTTTAGAGATCCTAGAGGGTGTCTTACATGCAAAGATGGCTATTTCTATAATGGAAGT
GAAGGAAGTTGCTAAAAATGTGATGAATCTTGCTCTAAATGTACTTATAGAAAAGATAAA
TGTATAGAATGTTCAAGTGGATATGAGTACGATGGTTATAATTAAAGATGTTACTAACTC
TGCCATGAAAGTTGCGAATCTTGTACAGCTCCTTAGAATCCCAAAGCATGTAAAAGCTGT
GCATATAACCATGTTATGTAGAATAATTTATGTGTTCCTTGTGACATAAATTGTATTGGC
TGTAGAGATGAACCTACAAAATGTATCGAATGCGTAGCAGGTTATAAGTTTGATCATTCT
TAGTAAACTTGTGTTAGTGTTTGTAACCCAGGTGAGTACTAAGATACAGATGGTAGCTGC
TAAAAGTGTGTATCTCCTTGCGCCACTTGCTAGTATTAGAGTGATTTCTGTTATAGCTGT
ATTTCTGGCTATACTTATAATGCTCAAATCAATTATTGTATTCCAAATACAAATTCTTGT
CATGAAAGTTGTAATTAATGCAGCTAAAATAATGATCCTAATTCATGTACTTCCTGTAGA
GATGGAATGTATTTATCATCTGGAAAATGTTAGTATTGCAGCAATAAGTGTTAAACCTGC
GAATTTGGTCCTAATAAATGCACTTCTTGCTAAAGCAATGAATTTTTATTAAACAACCAG
TGCCAATAATGCCATAATAGTTGCTTAACTTGCTCGGGAAAAGCAACAAATTGTACTTCT
TGTTAAGATGGCTTATTAAAAGATCCAAAAACTGGAATCTGTATTATGAATACACCTATT
TGTAGAAGTAATGAATATTTGGATAGTAAAAACTAATGTTAGAAATGTCTTTCTCCTTGT
GCTTCTTGTTCCAATTAACCTTACATGTGTTCAAGTTGTATTTCAGGCTATAAATTAAAT
AGTTAAACACTTTAATGTGAATAGGATATAATTACTTGTAAAGATGGGTAATTCTTAGAT
TAAAACAATAAATGCAAGCCTTGTCATTCTTTTTGCAACACCTGCGAGTAATAAAGTGAT
AGATGTACCAGTTGTAGACCTGGTCTTCTCCTTATATAATCCTTTTGCTATGATGAAGTA
TGCTAAGATGGGTATTTCAAGAACTAATAAGGTAAATGTTAAAGATGTAGTGAATCTTGC
TCTAAATGTGTAAACTACTAAGATTAATGTACTGAATGTGCTAATGAATACACTTTAGAC
TCTAGGACATAAAGATGTATTAAAAACTCAAGCAATTAGAAATGCCATCCTAATTGTAAG
GAATGTAGCTAACCAAACAATGCCCTTGCTTGTTATTCCTGCAAAGATGGTCTATTCTTA
AATAACAGAAGAGAATGTGTTCAATGTGATAATTCTTGTTTGACATGTGATAGATATTAA
GATTTTTGTACTTCTTGCTAATAAGGATATAAGTTAGATGCTACAGGTGGTAAATGTACT
CCTGATTGTAAATCAAATGAATATTTGGATAGTAAAAACTAATGTTAGAAATGTCTTTCT
CCTTGTGCTTCTTGTTCCAATTAACCTAATATGTGTTTAACTTGTATTTCCGGCTATAAA
TTAAATAGTTAAACACGTTAATGTGAATAAGATATAATTACTTGTAGAGATGGGTAATTC
TTAGATTAAAACAATAAATGCAAGCCTTGTCATTCTTTTTGCAACACCTGCGAGTAATAA
AGTGATAGATGTACCAGTTGTAGACCTGGTTTTCTCCTTATATAATCCTTTTGCTATGAT
GAAGTATGCTAAGATGGGTATTTCAAGAACTAATAAGGTAAATGTTAAAGATGTAGTGAA
TCTTGCTCTAAATGTGTAAACTACTAAGATTAATGTACTGAATGTGCTAATGAATACACT
TTAGACTCTAGGACATAAAGATGTATTAAAAACTCAAGCAATTAGAAATGCCATCCTAAT
TGTAAGGAATGTAGCTAACCAAACAATGCCCTTGCTTGTTATTCCTGCAAAGATGGTCTA
TTCTTAAATAACAGAAGAGAATGCGTTCAATGCGATAATTCTTGTTTGACATGTGATAGA
TATTAAGATTTTTGTACTTCTTGCTAATAAGGATATAAGTTAGATGCTAAAGATGGTAAA
TGTACTCCTGATTGTAAATCAAATGAATATTTAGATTTCTATGAAAATAAGTGTAAACCA
TGTACATCTCCTTGTGGAAGCTGCGAATATTATCCAGATAGATGTACTAGCTGCATTTCA
GGATATAAATACGACAACGAAGGGTATAGTTGTGAAATCATTTGTCAACCTGGATAATAT
GCTGATAGAGATCAAATATGCAAACCTTGTTCATCTCCATGTGCAACTTGTGAATACTAT
GATAATAGATGTTTGAGTTGTGTTTCTGGTTATACTTACACCAACTACAATTGTTAATAA
ACTTCAAGGCCTAGTATGAGAGGTTGTCATGAATCTTGTAATACATGCACAAGAGCTATG
GATCCTCGTTCATGTGACTCTTGTAGAGAAGGATATGTACTAATGAGTGGATCTTGCCAA
AAAAAGAAAGGAAATTATTCTAACCCTAAAAATTGA


>TTHERM_00543580(protein)
MNKVTLLLLLTALLVNSQFTDKKVVNSCLQDEIDMSKIVPQDYLETFDEKYGQRKLQRSE
PQPFRITLDFNELDNPLNGAGMTPSLKEYIKKIMYAAQTFLNKLIKVHPRQKPNKYTWFN
HLCYDTLLSEQIKTVGVDNSDLHIFVTYGNERASYVANAIWCNLDPNPNVGRVKFNLGNM
FIDETSGQSFLDYFSVALHEIMHILGFSGNSIQYWIDPDTGSAYGYWSVEKILKKERRWD
IENVTKISSKNLLKVSRNHYNCPSIDGMYLENQGEGGSFGSHWERDLLGNEFMTASTVFG
YYTISEFTAALLLDTGYYAEINQNLLMPLYWGKNKGCDFFNKSCNAGKYFAEFSDDTTRE
GCDFYSYGIGRRYKTDPFSQCENIVISIQGRCDSDDFKSENFFRQNPGAGSRCFRSNSNA
KGENFLNIQGRCFKAQCSNDLSSIKVNVWENEFVTCQYPNQVINLAEQTKTTQGVMKCPD
DFELFCGFPKQCPNKCSSNGICINGFCICLKGYAGDDCSKRCGEDQVWDGAHCTLNCPSG
LFKNFDNTCKTTCPYKQYGDQATRSCAVCSNKCSACFGPSSNQCISCNNGFILQGNQCIE
ATCHSSCQTCSGPNANQCTSCPSGTYLDSSKTCQPCQAPCESCFNSATECTTCVKDYEID
KASGQCIFSKVCDISCQDCYVFRDPRGCLTCKDGYFYNGSEGSCQKCDESCSKCTYRKDK
CIECSSGYEYDGYNQRCYQLCHESCESCTAPQNPKACKSCAYNHVMQNNLCVPCDINCIG
CRDEPTKCIECVAGYKFDHSQQTCVSVCNPGEYQDTDGSCQKCVSPCATCQYQSDFCYSC
ISGYTYNAQINYCIPNTNSCHESCNQCSQNNDPNSCTSCRDGMYLSSGKCQYCSNKCQTC
EFGPNKCTSCQSNEFLLNNQCQQCHNSCLTCSGKATNCTSCQDGLLKDPKTGICIMNTPI
CRSNEYLDSKNQCQKCLSPCASCSNQPYMCSSCISGYKLNSQTLQCEQDIITCKDGQFLD
QNNKCKPCHSFCNTCEQQSDRCTSCRPGLLLIQSFCYDEVCQDGYFKNQQGKCQRCSESC
SKCVNYQDQCTECANEYTLDSRTQRCIKNSSNQKCHPNCKECSQPNNALACYSCKDGLFL
NNRRECVQCDNSCLTCDRYQDFCTSCQQGYKLDATGGKCTPDCKSNEYLDSKNQCQKCLS
PCASCSNQPNMCLTCISGYKLNSQTRQCEQDIITCRDGQFLDQNNKCKPCHSFCNTCEQQ
SDRCTSCRPGFLLIQSFCYDEVCQDGYFKNQQGKCQRCSESCSKCVNYQDQCTECANEYT
LDSRTQRCIKNSSNQKCHPNCKECSQPNNALACYSCKDGLFLNNRRECVQCDNSCLTCDR
YQDFCTSCQQGYKLDAKDGKCTPDCKSNEYLDFYENKCKPCTSPCGSCEYYPDRCTSCIS
GYKYDNEGYSCEIICQPGQYADRDQICKPCSSPCATCEYYDNRCLSCVSGYTYTNYNCQQ
TSRPSMRGCHESCNTCTRAMDPRSCDSCREGYVLMSGSCQKKKGNYSNPKN


>TTHERM_00543580(gene)
ATGAATAAAGTTACTTTATTGCTATTGTTAACAGCTTTATTAGTAAATTCACAATTTACT
GATAAAAAGGTTGTTAACTCTTGCTTACAAGACGAAATCGATATGAGTAAAATTGTTCCA
TAAGACTACTTAGAAACGTTTGATGAAAAATATGGATAAAGAAAGCTCCAAAGGTCTGAG
CCCTAACCTTTTAGAATTACACTTGATTTTAATGAATTAGACAATCCTCTAAATGGAGCT
GGAATGACTCCAAGTTTAAAAGAATACATTAAGAAAATTATGTATGCTGCTTAGACATTT
TTGAACAAGCTCATTAAGGTACATCCTAGATAAAAACCAAATAAATATACTTGGTTTAAT
CATCTTTGTTATGATACATTACTTTCTGAATAGATAAAAACAGTTGGTGTAGATAATTCT
GATTTACATATTTTTGTTACCTATGGTAATGAACGCGCTTCATATGTAGCAAATGCAAGT
AAATTAATTTTTATTAAAAGTTTATAATTTTATTTAATATTAATTTATTATTAAATAGTT
TGGTGTAACTTAGATCCTAATCCTAATGTTGGAAGAGTTAAATTCAATTTAGGAAATATG
TTTATAGATGAAACATCTGGTTAGTCTTTCTTGGATTACTTTTCAGTTGCCTTGCATGAA
ATTATGCATATCTTAGGTTTCTCAGGTAATAGTATTTAATATTGGATTGATCCTGATACA
GGTAGCGCTTATGGTTACTGGAGTGTTGAAAAAATATTGAAAAAAGAAAGAAGATGGGAT
ATTGAAAATGTAACAAAGATATCTTCTAAAAATCTTTTGAAAGTTTCCAGAAATCACTAT
AATTGTCCTTCAATTGATGGCATGTACCTTGAAAATTAAGGTGAAGGTGGCTCTTTTGGT
TCACATTGGGAAAGAGATTTACTTGGAAATGAATTTATGACTGCAAGTACGGTCTTTGGC
TACTATACTATATCTGAATTTACAGCTGCTCTCCTTTTAGATACTGGTTATTATGCTGAA
ATCAATCAAAATCTCCTTATGCCTCTTTACTGGGGTAAAAATAAAGGCTGTGACTTCTTC
AATAAATCATGCAACGCTGGAAAGTACTTTGCTGAATTCTCAGATGATACTACCAGAGAA
GGTTGTGATTTTTACTCTTATGGTATTGGTCGTCGCTATAAAACTGATCCATTCTCGTAA
TGTGAAAATATTGTAATCAGCATTTAAGGTAGATGTGATTCTGATGACTTTAAATCTGAA
AACTTTTTCAGATAAAACCCTGGTGCTGGCTCTAGATGTTTTAGATCAAATTCAAATGCC
AAAGGAGAAAACTTTTTGAATATTTAAGGCAGATGCTTTAAGGCATAATGTTCAAACGAT
TTATCATCAATTAAAGTTAATGTTTGGGAAAACGAATTTGTTACTTGCTAATACCCAAAT
TAAGTTATTAATTTGGCAGAATAAACTAAAACTACTTAAGGTGTTATGAAATGCCCTGAT
GATTTTGAATTGTTTTGTGGTTTCCCTAAATAATGCCCAAATAAATGTTCAAGTAATGGT
ATTTGTATTAATGGATTTTGTATTTGCTTAAAAGGATATGCTGGGGACGATTGCTCTAAA
AGATGTGGTGAGGATTAAGTTTGGGATGGCGCACACTGCACATTAAATTGCCCTTCTGGA
TTATTTAAGAATTTTGATAACACTTGCAAGACCACTTGTCCTTATAAGTAATATGGAGAT
TAAGCAACACGTAGTTGTGCTGTTTGCTCTAATAAATGTTCTGCATGTTTTGGTCCCTCT
TCTAATTAATGTATTTCTTGCAATAACGGTTTTATTCTTTAAGGAAATCAATGTATAGAA
GCTACTTGTCATTCAAGTTGTCAAACATGCTCAGGACCTAATGCCAATTAGTGCACTTCT
TGTCCATCTGGAACATATTTAGACTCAAGTAAGACTTGTCAACCTTGCTAGGCTCCATGT
GAAAGCTGTTTCAATTCAGCAACTGAATGCACAACTTGTGTTAAGGATTATGAAATTGAT
AAAGCAAGTGGGTAATGTATTTTTAGCAAGGTTTGTGATATTTCTTGTCAAGATTGTTAT
GTGTTTAGAGATCCTAGAGGGTGTCTTACATGCAAAGATGGCTATTTCTATAATGGAAGT
GAAGGAAGTTGCTAAAAATGTGATGAATCTTGCTCTAAATGTACTTATAGAAAAGATAAA
TGTATAGAATGTTCAAGTGGATATGAGTACGATGGTTATAATTAAAGATGTTACTAACTC
TGCCATGAAAGTTGCGAATCTTGTACAGCTCCTTAGAATCCCAAAGCATGTAAAAGCTGT
GCATATAACCATGTTATGTAGAATAATTTATGTGTTCCTTGTGACATAAATTGTATTGGC
TGTAGAGATGAACCTACAAAATGTATCGAATGCGTAGCAGGTTATAAGTTTGATCATTCT
TAGTAAACTTGTGTTAGTGTTTGTAACCCAGGTGAGTACTAAGATACAGATGGTAGCTGC
TAAAAGTGTGTATCTCCTTGCGCCACTTGCTAGTATTAGAGTGATTTCTGTTATAGCTGT
ATTTCTGGCTATACTTATAATGCTCAAATCAATTATTGTATTCCAAATACAAATTCTTGT
CATGAAAGTTGTAATTAATGCAGCTAAAATAATGATCCTAATTCATGTACTTCCTGTAGA
GATGGAATGTATTTATCATCTGGAAAATGTTAGTATTGCAGCAATAAGTGTTAAACCTGC
GAATTTGGTCCTAATAAATGCACTTCTTGCTAAAGCAATGAATTTTTATTAAACAACCAG
TGCCAATAATGCCATAATAGTTGCTTAACTTGCTCGGGAAAAGCAACAAATTGTACTTCT
TGTTAAGATGGCTTATTAAAAGATCCAAAAACTGGAATCTGTATTATGAATACACCTATT
TGTAGAAGTAATGAATATTTGGATAGTAAAAACTAATGTTAGAAATGTCTTTCTCCTTGT
GCTTCTTGTTCCAATTAACCTTACATGTGTTCAAGTTGTATTTCAGGCTATAAATTAAAT
AGTTAAACACTTTAATGTGAATAGGATATAATTACTTGTAAAGATGGGTAATTCTTAGAT
TAAAACAATAAATGCAAGCCTTGTCATTCTTTTTGCAACACCTGCGAGTAATAAAGTGAT
AGATGTACCAGTTGTAGACCTGGTCTTCTCCTTATATAATCCTTTTGCTATGATGAAGTA
TGCTAAGATGGGTATTTCAAGAACTAATAAGGTAAATGTTAAAGATGTAGTGAATCTTGC
TCTAAATGTGTAAACTACTAAGATTAATGTACTGAATGTGCTAATGAATACACTTTAGAC
TCTAGGACATAAAGATGTATTAAAAACTCAAGCAATTAGAAATGCCATCCTAATTGTAAG
GAATGTAGCTAACCAAACAATGCCCTTGCTTGTTATTCCTGCAAAGATGGTCTATTCTTA
AATAACAGAAGAGAATGTGTTCAATGTGATAATTCTTGTTTGACATGTGATAGATATTAA
GATTTTTGTACTTCTTGCTAATAAGGATATAAGTTAGATGCTACAGGTGGTAAATGTACT
CCTGATTGTAAATCAAATGAATATTTGGATAGTAAAAACTAATGTTAGAAATGTCTTTCT
CCTTGTGCTTCTTGTTCCAATTAACCTAATATGTGTTTAACTTGTATTTCCGGCTATAAA
TTAAATAGTTAAACACGTTAATGTGAATAAGATATAATTACTTGTAGAGATGGGTAATTC
TTAGATTAAAACAATAAATGCAAGCCTTGTCATTCTTTTTGCAACACCTGCGAGTAATAA
AGTGATAGATGTACCAGTTGTAGACCTGGTTTTCTCCTTATATAATCCTTTTGCTATGAT
GAAGTATGCTAAGATGGGTATTTCAAGAACTAATAAGGTAAATGTTAAAGATGTAGTGAA
TCTTGCTCTAAATGTGTAAACTACTAAGATTAATGTACTGAATGTGCTAATGAATACACT
TTAGACTCTAGGACATAAAGATGTATTAAAAACTCAAGCAATTAGAAATGCCATCCTAAT
TGTAAGGAATGTAGCTAACCAAACAATGCCCTTGCTTGTTATTCCTGCAAAGATGGTCTA
TTCTTAAATAACAGAAGAGAATGCGTTCAATGCGATAATTCTTGTTTGACATGTGATAGA
TATTAAGATTTTTGTACTTCTTGCTAATAAGGATATAAGTTAGATGCTAAAGATGGTAAA
TGTACTCCTGATTGTAAATCAAATGAATATTTAGATTTCTATGAAAATAAGTGTAAACCA
TGTACATCTCCTTGTGGAAGCTGCGAATATTATCCAGATAGATGTACTAGCTGCATTTCA
GGATATAAATACGACAACGAAGGGTATAGTTGTGAAATCATTTGTCAACCTGGATAATAT
GCTGATAGAGATCAAATATGCAAACCTTGTTCATCTCCATGTGCAACTTGTGAATACTAT
GATAATAGATGTTTGAGTTGTGTTTCTGGTTATACTTACACCAACTACAATTGTTAATAA
ACTTCAAGGCCTAGTATGAGAGGTTGTCATGAATCTTGTAATACATGCACAAGAGCTATG
GATCCTCGTTCATGTGACTCTTGTAGAGAAGGATATGTACTAATGAGTGGATCTTGCCAA
AAAAAGAAAGGAAATTATTCTAACCCTAAAAATTGA