Identifiers and Description

Gene Model Identifier

TTHERM_00543570

Standard Name

LSF10 (Fusion of leishmanolysin-like peptidase and subtilisin-like proprotein convertase)

Aliases

PreTt15005 | 71.m00132 | 3729.m00012

Description

Fusion of leishmanolysin-like peptidase and subtilisin-like proprotein convertase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF04942 ) CC domain
  • ( PF00855 ) PWWP domain
  • ( PF09146 ) BmKK2 toxic
  • ( PF03128 ) CXCXC repeat
  • ( PF01457 ) Leishmanolysin
  • ( PF00008 ) EGF-like domain
  • ( PF07974 ) EGF-like domain
  • ( PF00304 ) Gamma-thionin family
  • ( PF02363 ) Cysteine rich repeat
  • ( PF00020 ) TNFR/NGFR cysteine-rich region
  • ( PF00684 ) DnaJ central domain (4 repeats)
  • ( PF00757 ) Furin-like cysteine rich region
  • ( PF00053 ) Laminin EGF-like (Domains III and
  • ( PF07754 ) Domain of unknown function (DUF1610)
  • ( PF07562 ) Nine Cysteines Domain of family
  • ( PF03302 ) Giardia variant-specific surface protein
  • ( PF09064 ) Thrombomodulin like fifth domain, EGF-like
  • ( PF01826 ) Trypsin Inhibitor like cysteine rich
  • ( PF00220 ) Neurohypophysial hormones, N-terminal Domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00543570

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17014.19.997093137033517e-262leishmanolysin family protein
(1343 aa)
Stentor CoeruleusSteCoe_318441.2160992992528256e-37
OxytrichaContig18862.0.g771.0002124404074584e-26hypothetical protein
DictyBaseDDB_G02933642.999534586690157e-23sigB on chromosome: 6 position
2822106 to 2824254
WormBaseWBGene000127961.9999391735788327e-19Leishmanolysin-like peptidase
status:Partially_confirmed
UniProt:O62446 protein_id:C
AB16471.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00543570(coding)
ATGAATGGTCTTACTATCATAGCATTCCTAATTACTTCTTTAGTCTATGCTTAAAGTTCT
GACAAATAGCTTGTTTATTCTTGTTTACAAGAGGAAATAGACATGAGTGAAATGGTTCCT
GAAGATTTCTTAGAAACATATGAAGAGAAGTATGGTAATCGAAAACTCTAAAATCAAGAG
CCTTAGCCTATCAGAATTACTCTAGATTTCAAAGAACTTGATAATGTTAAAAATGGTGAA
GGACTTACTGCTAACAAAAAGGAATACATTAAAAAAATTATGTATGCAGCTTAAATATAT
TTGAGTAAACTAATTAAAGTGAATCCAAGATAGCAACCTATTAAATTTCTAAAGTATACT
GATATTTGCTATGATGTCAAAGTTTCTCAAGAAATTAGAACAGATGGAATCTATGACTCC
GATTTACATATTTTTGTCACCTATACTAACTAGGAAGGCACCACTTTGGCTGATGCAATA
TCATGTTAATTGGATCCTTACCCTAATGTTGGAAGAGTTAAATTTAATATAGGTACTATG
ATAATTAATGAAGACGATACTTAGTCTTTCTAAGATAATTTCACAACTTCTTTGCATGAA
ATAATTCATATTTTAGGTTTCTCTGGAAGTAATATCTAATATTGGATTGATCCTGATACA
GGAAAACCTTATGGACTCACAAATGCACATAAGATTATGAAAAGAGAAAATAGGTGGGAT
GTAGATAATGTACTAAAGATATTTTCTAAGAATATTTTGAGAGTCTCAAGAAATCACTAT
GGTTGTCCTTTAATTGATGGTATGTACCTTGAAAACTAAGGTAAAGTTGGTTCCTTTAGC
TCTCATTGGGAAAGAGATCTGCTTGGAAACGAATTTATGACAGCCAGTCTTGTTTATCGT
GTTTCTACTATTTCTGAATTTACTGCAGCCCTACTACTTGACACTGGTTATTATGCTGAA
GTCAATTCTAATCTCTTAATGCCTATTTACTGGGGTAAGAATAAAGGATGTGATTTTTTT
AACAAGTCTTGCAATACGTCTTAATAATTCCCTGAATTCCCAGATGACAGTGAAGAAGAG
TCTTGCGATTTTTTCTCTTAAGGTATAGGTAAACTTTAAAAAGCAGGTACTTTTACTTAA
TGCAAGACAGTAACTATCAATAATAACCTTTATTGTTATTCTGATCAATTTAAGGCTAAT
GAATTCTTAAGATAAAATACTGGTTCTGGGTCTAAGTGTTTTAGATCAAATGCAAGTATC
AAAGGGTATGAAATTTTAGATATGAAAGGTCGATGCTTTAAGGCTTAATGTGCAAGCGAT
TTATCCTCTATTTAAGTTAGTATTTGGGGTGATGAATATGTCACTTGCAAATATCCAAAT
TAAGTTATTAGCTTATCTGAATAAACTATTAACACTCAAGGCATTATGAAATGCCCACAT
GATTTTGATTTATTTTGTAATTTCCCTAAATCTTGTCCCAATAATTGTTCAAACAATGGC
ATATGTAATAATGGTTACTGTATTTGTCTCAAATAATATGCTGGAGCTGATTGTTCTTAA
AAATGTGAGGAAGGTTAAGTTTGGGATGGTGCTCGCTGTGCATAAAGTTGTCCTTTTGGA
TAGTTCAAAAATTTTGATAATACTTGTAAACCTACTTGTCCTTACAAGCAATATGGAGAC
AGAAATACAGGAAGTTGTGTTCTTTGCCCAATAAATTGCTCAGCCTGTTTTGGTCCTACT
TTTAACCAATGTCTTTCATGCAATAATGGTTTTATGCTTTAAGGTAACTAATGTATTGAA
TTTACTTGTCACTCTAGTTGCTATTAGTGTTCAGGTCCAAATGCAAACTAATGTACATCC
TGTCCTTCTGGAAAGTATTTAGATTCAAATAAGACTTGCTAATCATGTTAATAACCATGT
GAAAACTGCTTTAATGAAGCTACTGAATGTACTACTTGTGCTTAAGGTTATAAAATGAAC
ACATCTAATGGAAGATGTGAATCAGTTAATAAATGTGACAGCTCTTGCCTTGAGTGTTCT
GATTAAAGAAATCCTACTAAATGTACTTCTTGCAGAAACGGCTATACTCTCGACTATTAA
GGAAAATGCCAAAAAATAATATGCTTCATTAATGAAATAATGCTAAATAACTAATGCGTT
CCATGTGATAAAAGTTGCGAAGGATGTGTAAATAATCCTAAAACATGTATTAATTGTGCA
AAAGGATATAAATTTGATTTTAGTAACAAAAATTGTGTCCCTAAATGCAATTAAGATGAT
TTCTTAGATAGATATGGTAATTGCTAATAATGTTAACCACCATGTGCTACATGTGAAGAT
TTTAATAATAATTGCATTAGTTGTGTAAATGGTTATACTCTTAATACCAATTATAATTCT
TGTGAACTTAAAAATTAAAAATGTCATGAAAGTTGCAATTCATGCAATAGATATAACGAT
TCTTATGGATGCACTTCTTGTAGAGATGGAATGTATCTAAATTCAGGAAGATGTTTACCA
TGTAACATCGAATGCTAAACTTGTGAAGATGCATCTTATAAATGTACTTCTTGTAAATAA
AATGAATACCTGTCAAAAATGAAATGCAAACAATGCCATGCTTCCTGCTTAACCTGTTCG
GATAAAGAAACAAATTGTACTTCTTGTAAAGAAGGTTTCCAAAAAGACTATAATTCAGGT
CTTTGCGTTCCTACTATTAAAAATTGTTAGTTTGATGAATATTTGGATAAAAATTATTAG
TGTTAAAAGTGCAACTCACCTTGTGTTTCTTGTTATTTAAATCCTAACAGATGTACAAGT
TGCATTTCTGGTTATGTACATAATACTTAAACAAATTAATGTGAAATTAATGATCCTATC
TGTGATTATGATTAGTTTTTGGATAGCTACAAAAATTGTAAGCCTTGCCATTAATCGTGT
GCAACATGTGAAGGCTATAGTACTAAATGCACTAGCTGTAAAAATGGGTTTATTCTTTTA
AGAAATGCGTGTTATGAATAAAGGTGCTCAGAAGGATTTTTCCTCAACTACTTGGGTAGA
TGTGTAAGATGTGATGATTCTTGCTTAAAATGTGATACATTTAAAGATAATTGTACAGAA
TGTGCTAATGGATTTACTTATGAAGCTAGCTCTTAAAGATGCATCAAAATCTTAAATAAT
AATTAATGTCATCCTACTTGTTAGGAATGTAACTAACCAAATAATTCATCTGCTTGTACA
TCTTGTAAAGAAGGTCTCCAAAAAGACTATAATTCAGGTCTTTGTGTTCCTACTATTAAA
AATTGCTAGTTTGATGAATATTTGGATATAAATTATTAGTGTTAAAAGTGCAACTCACCT
TGTTTTTCTTGTTATTTAAATCCTAACCAATGTACAAGTTGCATTTCTGGTTATGTACAT
AATACTTAAACAAATTAATGTGAAATTAATGATCCTATCTGTGATTATGATTAGTTTTTG
GATAGCTACAAAAATTGTAAGCCTTGTCATTAATCGTGTGCAACATGTGAAGGCTATAGT
AATAAATGCACTAGCTGTAAAAATGGGTTTATTCTTTTTAGAAATGCATGTTATGAATAA
AAGTGCTCAGAAGGATTTTTCCTCAACAACTTTGGTAGATGTGTAAGATGCGATGATTCT
TGCTTAAAATGTGATACATTTAAAGATAATTGTACAGAATGTGCTAATGGATTTACTTAT
GAAGCTAGCTCATAGAAATGCATCAAAATCTTAAATAATAATTAATGTCATCCTACTTGT
TAGGAATGTAGCTAACCAAATAATTCATCTGCTTGTACATCTTGTAATGATGGTTATTTC
ATTTTTAATGGTATGTGTATTTAATGCAGCAGCTAATGTTTGACGTGTAAAAGAAAATCT
AATTTTTGCACTTAGTGCAAATAAGGTTTTAGATTAGACAGCATTTTCGGTAGGTGTATT
TAAGATTGCTAATAAAGATATTATTTTAATTAAACAAATAACTAATGCTAACCTTGCTTA
TCTCCTTGTGAAAATTGTGAGTATTATTCTTATAGATGTACTAGTTGTATTTAAGGATAC
AAATATGACAATGATAGTTTTGCATGTGAGATTGATTGCAAACCAGGAGAATATAAAAAT
ACAATTTAATCATGTAAGCAGTGTTCATTTCCATGTTTAACCTGTGAATTTGATGATAAT
AGATGTTTAAGTTGTGTATCTGGATATACTTATAGAGATTATTCATGCTAAAAGAACTCT
AGGTCTAATTTTAGAGCTTGCCATGAATCTTGTAATACCTGCATAAAAGCTATGGATCCT
CATTCTTGTGATTCATGCAGGGAAGGATATACCTTAATAAATGGCACCTGCTATAAAAAA
TGA


>TTHERM_00543570(protein)
MNGLTIIAFLITSLVYAQSSDKQLVYSCLQEEIDMSEMVPEDFLETYEEKYGNRKLQNQE
PQPIRITLDFKELDNVKNGEGLTANKKEYIKKIMYAAQIYLSKLIKVNPRQQPIKFLKYT
DICYDVKVSQEIRTDGIYDSDLHIFVTYTNQEGTTLADAISCQLDPYPNVGRVKFNIGTM
IINEDDTQSFQDNFTTSLHEIIHILGFSGSNIQYWIDPDTGKPYGLTNAHKIMKRENRWD
VDNVLKIFSKNILRVSRNHYGCPLIDGMYLENQGKVGSFSSHWERDLLGNEFMTASLVYR
VSTISEFTAALLLDTGYYAEVNSNLLMPIYWGKNKGCDFFNKSCNTSQQFPEFPDDSEEE
SCDFFSQGIGKLQKAGTFTQCKTVTINNNLYCYSDQFKANEFLRQNTGSGSKCFRSNASI
KGYEILDMKGRCFKAQCASDLSSIQVSIWGDEYVTCKYPNQVISLSEQTINTQGIMKCPH
DFDLFCNFPKSCPNNCSNNGICNNGYCICLKQYAGADCSQKCEEGQVWDGARCAQSCPFG
QFKNFDNTCKPTCPYKQYGDRNTGSCVLCPINCSACFGPTFNQCLSCNNGFMLQGNQCIE
FTCHSSCYQCSGPNANQCTSCPSGKYLDSNKTCQSCQQPCENCFNEATECTTCAQGYKMN
TSNGRCESVNKCDSSCLECSDQRNPTKCTSCRNGYTLDYQGKCQKIICFINEIMLNNQCV
PCDKSCEGCVNNPKTCINCAKGYKFDFSNKNCVPKCNQDDFLDRYGNCQQCQPPCATCED
FNNNCISCVNGYTLNTNYNSCELKNQKCHESCNSCNRYNDSYGCTSCRDGMYLNSGRCLP
CNIECQTCEDASYKCTSCKQNEYLSKMKCKQCHASCLTCSDKETNCTSCKEGFQKDYNSG
LCVPTIKNCQFDEYLDKNYQCQKCNSPCVSCYLNPNRCTSCISGYVHNTQTNQCEINDPI
CDYDQFLDSYKNCKPCHQSCATCEGYSTKCTSCKNGFILLRNACYEQRCSEGFFLNYLGR
CVRCDDSCLKCDTFKDNCTECANGFTYEASSQRCIKILNNNQCHPTCQECNQPNNSSACT
SCKEGLQKDYNSGLCVPTIKNCQFDEYLDINYQCQKCNSPCFSCYLNPNQCTSCISGYVH
NTQTNQCEINDPICDYDQFLDSYKNCKPCHQSCATCEGYSNKCTSCKNGFILFRNACYEQ
KCSEGFFLNNFGRCVRCDDSCLKCDTFKDNCTECANGFTYEASSQKCIKILNNNQCHPTC
QECSQPNNSSACTSCNDGYFIFNGMCIQCSSQCLTCKRKSNFCTQCKQGFRLDSIFGRCI
QDCQQRYYFNQTNNQCQPCLSPCENCEYYSYRCTSCIQGYKYDNDSFACEIDCKPGEYKN
TIQSCKQCSFPCLTCEFDDNRCLSCVSGYTYRDYSCQKNSRSNFRACHESCNTCIKAMDP
HSCDSCREGYTLINGTCYKK


>TTHERM_00543570(gene)
GTATAATATAAAGTTAAATATAAAAATACCAAACATAACAAACAACTTATAAAAATGAAT
GGTCTTACTATCATAGCATTCCTAATTACTTCTTTAGTCTATGCTTAAAGTTCTGACAAA
TAGCTTGTTTATTCTTGTTTACAAGAGGAAATAGACATGAGTGAAATGGTTCCTGAAGAT
TTCTTAGAAACATATGAAGAGAAGTATGGTAATCGAAAACTCTAAAATCAAGAGCCTTAG
CCTATCAGAATTACTCTAGATTTCAAAGAACTTGATAATGTTAAAAATGGTGAAGGACTT
ACTGCTAACAAAAAGGAATACATTAAAAAAATTATGTATGCAGCTTAAATATATTTGAGT
AAACTAATTAAAGTGAATCCAAGATAGCAACCTATTAAATTTCTAAAGTATACTGATATT
TGCTATGATGTCAAAGTTTCTCAAGAAATTAGAACAGATGGAATCTATGACTCCGATTTA
CATATTTTTGTCACCTATACTAACTAGGAAGGCACCACTTTGGCTGATGCAAGTAATAAA
TTTATCTTTAATAGCTTATCCTAATATTATTAATAATTTAAAAAGTATCATGTTAATTGG
ATCCTTACCCTAATGTTGGAAGAGTTAAATTTAATATAGGTACTATGATAATTAATGAAG
ACGATACTTAGTCTTTCTAAGATAATTTCACAACTTCTTTGCATGAAATAATTCATATTT
TAGGTTTCTCTGGAAGTAATATCTAATATTGGATTGATCCTGATACAGGAAAACCTTATG
GACTCACAAATGCACATAAGATTATGAAAAGAGAAAATAGGTGGGATGTAGATAATGTAC
TAAAGATATTTTCTAAGAATATTTTGAGAGTCTCAAGAAATCACTATGGTTGTCCTTTAA
TTGATGGTATGTACCTTGAAAACTAAGGTAAAGTTGGTTCCTTTAGCTCTCATTGGGAAA
GAGATCTGCTTGGAAACGAATTTATGACAGCCAGTCTTGTTTATCGTGTTTCTACTATTT
CTGAATTTACTGCAGCCCTACTACTTGACACTGGTTATTATGCTGAAGTCAATTCTAATC
TCTTAATGCCTATTTACTGGGGTAAGAATAAAGGATGTGATTTTTTTAACAAGTCTTGCA
ATACGTCTTAATAATTCCCTGAATTCCCAGATGACAGTGAAGAAGAGTCTTGCGATTTTT
TCTCTTAAGGTATAGGTAAACTTTAAAAAGCAGGTACTTTTACTTAATGCAAGACAGTAA
CTATCAATAATAACCTTTATTGTTATTCTGATCAATTTAAGGCTAATGAATTCTTAAGAT
AAAATACTGGTTCTGGGTCTAAGTGTTTTAGATCAAATGCAAGTATCAAAGGGTATGAAA
TTTTAGATATGAAAGGTCGATGCTTTAAGGCTTAATGTGCAAGCGATTTATCCTCTATTT
AAGTTAGTATTTGGGGTGATGAATATGTCACTTGCAAATATCCAAATTAAGTTATTAGCT
TATCTGAATAAACTATTAACACTCAAGGCATTATGAAATGCCCACATGATTTTGATTTAT
TTTGTAATTTCCCTAAATCTTGTCCCAATAATTGTTCAAACAATGGCATATGTAATAATG
GTTACTGTATTTGTCTCAAATAATATGCTGGAGCTGATTGTTCTTAAAAATGTGAGGAAG
GTTAAGTTTGGGATGGTGCTCGCTGTGCATAAAGTTGTCCTTTTGGATAGTTCAAAAATT
TTGATAATACTTGTAAACCTACTTGTCCTTACAAGCAATATGGAGACAGAAATACAGGAA
GTTGTGTTCTTTGCCCAATAAATTGCTCAGCCTGTTTTGGTCCTACTTTTAACCAATGTC
TTTCATGCAATAATGGTTTTATGCTTTAAGGTAACTAATGTATTGAATTTACTTGTCACT
CTAGTTGCTATTAGTGTTCAGGTCCAAATGCAAACTAATGTACATCCTGTCCTTCTGGAA
AGTATTTAGATTCAAATAAGACTTGCTAATCATGTTAATAACCATGTGAAAACTGCTTTA
ATGAAGCTACTGAATGTACTACTTGTGCTTAAGGTTATAAAATGAACACATCTAATGGAA
GATGTGAATCAGTTAATAAATGTGACAGCTCTTGCCTTGAGTGTTCTGATTAAAGAAATC
CTACTAAATGTACTTCTTGCAGAAACGGCTATACTCTCGACTATTAAGGAAAATGCCAAA
AAATAATATGCTTCATTAATGAAATAATGCTAAATAACTAATGCGTTCCATGTGATAAAA
GTTGCGAAGGATGTGTAAATAATCCTAAAACATGTATTAATTGTGCAAAAGGATATAAAT
TTGATTTTAGTAACAAAAATTGTGTCCCTAAATGCAATTAAGATGATTTCTTAGATAGAT
ATGGTAATTGCTAATAATGTTAACCACCATGTGCTACATGTGAAGATTTTAATAATAATT
GCATTAGTTGTGTAAATGGTTATACTCTTAATACCAATTATAATTCTTGTGAACTTAAAA
ATTAAAAATGTCATGAAAGTTGCAATTCATGCAATAGATATAACGATTCTTATGGATGCA
CTTCTTGTAGAGATGGAATGTATCTAAATTCAGGAAGATGTTTACCATGTAACATCGAAT
GCTAAACTTGTGAAGATGCATCTTATAAATGTACTTCTTGTAAATAAAATGAATACCTGT
CAAAAATGAAATGCAAACAATGCCATGCTTCCTGCTTAACCTGTTCGGATAAAGAAACAA
ATTGTACTTCTTGTAAAGAAGGTTTCCAAAAAGACTATAATTCAGGTCTTTGCGTTCCTA
CTATTAAAAATTGTTAGTTTGATGAATATTTGGATAAAAATTATTAGTGTTAAAAGTGCA
ACTCACCTTGTGTTTCTTGTTATTTAAATCCTAACAGATGTACAAGTTGCATTTCTGGTT
ATGTACATAATACTTAAACAAATTAATGTGAAATTAATGATCCTATCTGTGATTATGATT
AGTTTTTGGATAGCTACAAAAATTGTAAGCCTTGCCATTAATCGTGTGCAACATGTGAAG
GCTATAGTACTAAATGCACTAGCTGTAAAAATGGGTTTATTCTTTTAAGAAATGCGTGTT
ATGAATAAAGGTGCTCAGAAGGATTTTTCCTCAACTACTTGGGTAGATGTGTAAGATGTG
ATGATTCTTGCTTAAAATGTGATACATTTAAAGATAATTGTACAGAATGTGCTAATGGAT
TTACTTATGAAGCTAGCTCTTAAAGATGCATCAAAATCTTAAATAATAATTAATGTCATC
CTACTTGTTAGGAATGTAACTAACCAAATAATTCATCTGCTTGTACATCTTGTAAAGAAG
GTCTCCAAAAAGACTATAATTCAGGTCTTTGTGTTCCTACTATTAAAAATTGCTAGTTTG
ATGAATATTTGGATATAAATTATTAGTGTTAAAAGTGCAACTCACCTTGTTTTTCTTGTT
ATTTAAATCCTAACCAATGTACAAGTTGCATTTCTGGTTATGTACATAATACTTAAACAA
ATTAATGTGAAATTAATGATCCTATCTGTGATTATGATTAGTTTTTGGATAGCTACAAAA
ATTGTAAGCCTTGTCATTAATCGTGTGCAACATGTGAAGGCTATAGTAATAAATGCACTA
GCTGTAAAAATGGGTTTATTCTTTTTAGAAATGCATGTTATGAATAAAAGTGCTCAGAAG
GATTTTTCCTCAACAACTTTGGTAGATGTGTAAGATGCGATGATTCTTGCTTAAAATGTG
ATACATTTAAAGATAATTGTACAGAATGTGCTAATGGATTTACTTATGAAGCTAGCTCAT
AGAAATGCATCAAAATCTTAAATAATAATTAATGTCATCCTACTTGTTAGGAATGTAGCT
AACCAAATAATTCATCTGCTTGTACATCTTGTAATGATGGTTATTTCATTTTTAATGGTA
TGTGTATTTAATGCAGCAGCTAATGTTTGACGTGTAAAAGAAAATCTAATTTTTGCACTT
AGTGCAAATAAGGTTTTAGATTAGACAGCATTTTCGGTAGGTGTATTTAAGATTGCTAAT
AAAGATATTATTTTAATTAAACAAATAACTAATGCTAACCTTGCTTATCTCCTTGTGAAA
ATTGTGAGTATTATTCTTATAGATGTACTAGTTGTATTTAAGGATACAAATATGACAATG
ATAGTTTTGCATGTGAGATTGATTGCAAACCAGGAGAATATAAAAATACAATTTAATCAT
GTAAGCAGTGTTCATTTCCATGTTTAACCTGTGAATTTGATGATAATAGATGTTTAAGTT
GTGTATCTGGATATACTTATAGAGATTATTCATGCTAAAAGAACTCTAGGTCTAATTTTA
GAGCTTGCCATGAATCTTGTAATACCTGCATAAAAGCTATGGATCCTCATTCTTGTGATT
CATGCAGGGAAGGATATACCTTAATAAATGGCACCTGCTATAAAAAATGA