Identifiers and Description

Gene Model Identifier

TTHERM_00600670

Standard Name

LSD2

Aliases

PreTt22130 | 83.m00199 | 3685.m00091

Description

amine oxidase, flavin-containing family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 44.9%

TetraMine Data

TTHERM_00600670

WebApollo

Fullscreen View

Tetrahymena Stock Center

  • ( SD01740 ) Micronucleus: PAR1 gene partially replaced by neo4-KanR2 cassette. Macronucleus: LSD2 gene partially replaced by neo4-KanR2 cassette.

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_47680
Tetrahymena borealisEI9_14924.19.997093137033517e-262amine oxidase, flavin-containi
ng family protein (455 aa)
DictyBaseDDB_G02892652.0008113830639685e-30DDB_G0289265 on chromosome: 5
position 2564981 to 2566834
WormBaseWBGene000001371.000116773704384e-19locus:amx-1 Amine oxidase fa
mily member 1 status:Partial
ly_confirmed UniProt:Q21988
protein_id:CAA84671.3
SGDYMR020W0.0000000039998859049333245FMS1 Polyamine oxidase, conver
ts spermine to spermidine, whi
ch is required for the essenti
al hypusination modification o
f translation factor eIF-5A; a
lso involved in pantothenic ac
id biosynthesis
OxytrichaContig18181.0.g400.000000004999139696582238Flavin containing amine oxidor
eductase

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00600670(coding)
ATGAGTACCAAACGGAAATCTGTTTTAATTATTGGTGCTGGTATATCTGGTTTAGCTGCT
GCTCATTCTTTGCATGAGAATGGATTTGATGTTCAAATTTTTGAAGCTCGAAAGGAGTTT
GGAGGAAGAATACGTAAGGATGATTCATTTGCTGGGTTCACCCTCGAGGTAGGCGGCGAG
GAAATCCACAAAGTGAACAGTCCTTATTACCATCTAGCCCTGAAAATGGGAGCTGATCTT
AAACCTGATGACACACTCAATCATTACTTTGAAGACATTGAAAAAGAAGAACTCATTGAT
AGAGAAGAATTTTTAAACAAGTACAATGACTAATACTTCTACAATGAAGTTGTTTAAAAT
AGAGACATCTAAGACGACTCTCAGTCACTCTAAAATTTCTTTACCAAAAAGGGACTAAAA
TCTCAATTTTACCAGTGGTACGAAGCTTTCTGGGGTATTGAAAACGGAGGTTCTCTGAAT
GAAATTTCTGTAAAAGCATACGGAGATTACGAAAGTGGTAGAAAGAGTGATCATGACTTA
AATTTCATATTGATGAACACTTCTCACTATGAGATCATTGAAAAAGCTTTTGAATCTGTA
TTACCTTTCATTCATTACTCTACTCCTATCACTGAAATCAACTACTTTGGTGAAAAAGAA
CACCCATTATAAAGAGACGAAGATGATGAAGATGAAGATAATGACGAAGATGACTGTAAA
GGAAAGGATTTCAATAGAGTTATCATTTTCGATAAGTAGGGAAATAGATACGAAGGAGAC
TATATCATTGTCACAGTTCCTATTTCTTAGTTGTAAAATAAAACAATTCGCTTTAATCCA
GAATTACCACCTTAAAAGTAAGATGCTATTCGTCGTATGAAGCTCGGAAGAGGAGGTAAA
ATCCATTTCAAATTTAAGAATAGATTCTGGCCTGATAATGCAAGGACAATCTTTTTAAGA
TCTAAAATCAGTTTCTTGTGGAATCAATACCACGAATAGAAAGATACTGATGAAATTCAA
ACTAATGTCTTGGCTGGTCTTTTAGCTGGTGATATTATGGATGAAATGCAAGATCCTGAA
AAAAGGTAGGCTCTTATTGATGAAGTTTTAGAAAAAATGACTCGTGTCTTCAAATACCCA
AATGCAAAGGAAGAATTATTAGATGTTATGTGGAATGATTTTACTAATTTTGAATACATC
TAAGGTAACTACTCAATGCCAACTTTAAATATTGGTAGCTCTCGCTATATTTATTAATAG
CCAGTTGATAACATACTATTCTTTGCTGGAGAAGCTTCTCATACTACCGATTCGATGACA
ATTCATGGTGCTTATGAGACAGGTTTGCGTGACGCATAGCGCATCATCGATCTTCAGAAG
GAAAAGAAGTGA


>TTHERM_00600670(protein)
MSTKRKSVLIIGAGISGLAAAHSLHENGFDVQIFEARKEFGGRIRKDDSFAGFTLEVGGE
EIHKVNSPYYHLALKMGADLKPDDTLNHYFEDIEKEELIDREEFLNKYNDQYFYNEVVQN
RDIQDDSQSLQNFFTKKGLKSQFYQWYEAFWGIENGGSLNEISVKAYGDYESGRKSDHDL
NFILMNTSHYEIIEKAFESVLPFIHYSTPITEINYFGEKEHPLQRDEDDEDEDNDEDDCK
GKDFNRVIIFDKQGNRYEGDYIIVTVPISQLQNKTIRFNPELPPQKQDAIRRMKLGRGGK
IHFKFKNRFWPDNARTIFLRSKISFLWNQYHEQKDTDEIQTNVLAGLLAGDIMDEMQDPE
KRQALIDEVLEKMTRVFKYPNAKEELLDVMWNDFTNFEYIQGNYSMPTLNIGSSRYIYQQ
PVDNILFFAGEASHTTDSMTIHGAYETGLRDAQRIIDLQKEKK


>TTHERM_00600670(gene)
ATGAGTACCAAACGGAAATCTGTTTTAATTATTGGTGCTGGTATATCTGGTTTAGCTGCT
GCTCATTCTTTGCATGAGAATGGATTTGATGTTCAAATTTTTGAAGCTCGAAAGGAGTTT
GGAGGAAGAATACGTAAGGATGATTCATTTGCTGGGTTCACCCTCGAGGTAGGCGGCGAG
GAAATCCACAAAGTGAACAGTCCTTATTACCATCTAGCCCTGAAAATGGGAGCTGATCTT
AAACCTGATGACACACTCAATCATTACTTTGAAGACATTGAAAAAGAAGAACTCATTGAT
AGAGAAGAATTTTTAAACAAGTACAATGACTAATACTTCTACAATGAAGTTGTTTAAAAT
AGAGACATCTAAGACGACTCTCAGTCACTCTAAAATTTCTTTACCAAAAAGGGACTAAAA
TCTCAATTTTACCAGTGGTACGAAGCTTTCTGGGGTATTGAAAACGGAGGTTCTCTGAAT
GAAATTTCTGTAAAAGCATACGGAGATTACGAAAGTGGTAGAAAGAGTGATCATGACTTA
AATTTCATATTGATGAACACTTCTCACTATGAGATCATTGAAAAAGCTTTTGAATCTGTA
TTACCTTTCATTCATTACTCTACTCCTATCACTGAAATCAACTACTTTGGTGAAAAAGAA
CACCCATTATAAAGAGACGAAGATGATGAAGATGAAGATAATGACGAAGATGACTGTAAA
GGAAAGGATTTCAATAGAGTTATCATTTTCGATAAGTAGGGAAATAGATACGAAGGAGAC
TATATCATTGTCACAGTTCCTATTTCTTAGTTGTAAAATAAAACAATTCGCTTTAATCCA
GAATTACCACCTTAAAAGTAAGATGCTATTCGTCGTATGAAGCTCGGAAGAGGAGGTAAA
ATCCATTTCAAATTTAAGAATAGATTCTGGCCTGATAATGCAAGGACAATCTTTTTAAGA
TCTAAAATCAGTTTCTTGTGGAATCAATACCACGAATAGAAAGATACTGATGAAATTCAA
ACTAATGTCTTGGCTGGTCTTTTAGCTGGTGATATTATGGATGAAATGCAAGATCCTGAA
AAAAGGTAGGCTCTTATTGATGAAGTTTTAGAAAAAATGACTCGTGTCTTCAAATACCCA
AATGCAAAGGAAGAATTATTAGATGTTATGTGGAATGATTTTACTAATTTTGAATACATC
TAAGGTAACTACTCAATGCCAACTTTAAATATTGGTAGCTCTCGCTATATTTATTAATAG
CCAGTTGATAACATACTATTCTTTGCTGGAGAAGCTTCTCATACTACCGATTCGATGACA
ATTCATGGTGCTTATGAGACAGGTTTGCGTGACGCATAGCGCATCATCGATCTTCAGAAG
GAAAAGAAGTGA