Identifiers and Description

Gene Model Identifier

TTHERM_00068140

Standard Name

LSC1 (Ligase of Succinyl-CoA  )

Aliases

PreTt13203 | 4.m00602 | 3707.m00239

Description

Alpha subunit of succinyl-CoA ligase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00549 ) CoA-ligase
  • ( PF02629 ) CoA binding domain
  • ( TIGR01019 ) succinate-CoA ligase, alpha subunit
  • ( PF01113 ) Dihydrodipicolinate reductase, N-terminus
  • ( PF01408 ) Oxidoreductase family, NAD-binding Rossmann fold
  • ( TIGR02717 ) acetyl coenzyme A synthetase (ADP

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.4%

TetraMine Data

TTHERM_00068140

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02112.19.997093137033517e-262succinyl-CoA synthetase, alpha
subunit protein (311 aa)
DictyBaseDDB_G02893257.998494937295598e-144scsA on chromosome: 5 position
2650999 to 2652299
OxytrichaContig13094.0.g1055.000301007691871e-141CoA binding domain
WormBaseWBGene000073505.997858334163121e-134locus:sucl-1 Probable succin
yl-CoA ligase [ADP/GDP-forming
] subunit alpha, mitochondrial
status:Confirmed UniProt:
P53596 protein_id:CAA94107.1
SGDYOR142W6.999054974866289e-109LSC1 Alpha subunit of succinyl
-CoA ligase, which is a mitoch
ondrial enzyme of the TCA cycl
e that catalyzes the nucleotid
e-dependent conversion of succ
inyl-CoA to succinate; phospho
rylated
Stentor CoeruleusSteCoe_352141.7785284761271306e-68

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00068140(coding)
ATGTTGTCAAAGACTATTTCCAATTTCTTCAGCTCTACCAAGCCCTACGTTTGGATTAAC
AAGCACACTAAGGTTATTTGCCAAGGTATCACTGGTAACCAAGGTACTTTACACACTCAA
CAAGCTCTTGAATACGGTACTAAGATGGTTGGTGGTGTCAATCCTGCTAAGGCTGGTCAA
ACCCACTTGGGCTTACCCGTTTTCAAGAACTGCCAAGAAGCCAAGAAAGTCACCGGTTGT
GATGCTTCCGTTATCTACGTTCCTCCCCCTCATGCTGCTAAGGCTATTATGGAAGCTATT
GAAGCTGAAATTCCCTTGGTCGTTGTCATCACCGATGGTATCCCATAACACGACATGGTC
AAGGTTAAGCACGCTCTTAGACAACAAAAGATTACCAGAATTATTGGTCCCAATTGCCCT
GGTATCATTAAGCCCAACGAATGTAAGATTGGTATTATGCCCGGTTACATTCACAAGCCT
GGTAAAATCGGTATCGTCTCAAGATCTGGTACTTTGACTTACGAAGCTGTTGACTAAACT
ACTAAGGCTGGTTTGGGTCAATCTACCGTCGTTGGTATTGGTGGTGATCCTTTCAACGGT
ACCAATTTCATCGATGTCCTCGAAAGATTCGTTGAAGATCCCGAAACTGAAGGTATTTTA
TTAATTGGTGAAATCGGTGGTGAAGCTGAAGAACAAGCTGCTGCCTGGTTGAAGGCTAAC
AATAAAACCAACAAGCCCGTTGTTTCTTTCATTGCTGGTGTTACTGCTCCTCCTGAGAGA
AGAATGGGTCACGCTGGTGCTATCGTTTCTGGTGGTAAGGGTTCTGCCACTGAAAAGATC
AAGGCTTTAGAATCTGCTGGCATTAAGGTCTGCAGATCTCCTGCCACCTTAGGTCAAGAA
ATGCTCAACCTCATGAAGGTCCATAAGAACTGA


>TTHERM_00068140(protein)
MLSKTISNFFSSTKPYVWINKHTKVICQGITGNQGTLHTQQALEYGTKMVGGVNPAKAGQ
THLGLPVFKNCQEAKKVTGCDASVIYVPPPHAAKAIMEAIEAEIPLVVVITDGIPQHDMV
KVKHALRQQKITRIIGPNCPGIIKPNECKIGIMPGYIHKPGKIGIVSRSGTLTYEAVDQT
TKAGLGQSTVVGIGGDPFNGTNFIDVLERFVEDPETEGILLIGEIGGEAEEQAAAWLKAN
NKTNKPVVSFIAGVTAPPERRMGHAGAIVSGGKGSATEKIKALESAGIKVCRSPATLGQE
MLNLMKVHKN


>TTHERM_00068140(gene)
ATGTTGTCAAAGACTATTTCCAATTTCTTCAGCTCTACCAAGCCCTACGTTTGGATTAAC
AAGCACACTAAGGTTATTTGCCAAGGTATCACTGGTAACCAAGTAAGAATTGATATCAAT
TTCTAAATTTTGAGCTATTTTCATTTGTTCTCCAGCTCGCTTTTGGATTTTAGCAAATGC
TCTCCCTTTCCTTCATTTTCTCTATTAGTCATTTTAAACCATATCCTCTTCAAATGAAAA
TATTTCTTCAGTTTGAAAGTTTCAAAGCAAATAGACCTTAAAAAGTAAAATAGCCATGAA
AATAAAAATGATTATCAAGTATCAAAAAATACAAATTAAGCAGTCAAATTGTAAAAAATC
GAAGCAAATAAATAAAGTCCAATTCAAATTTCAGCAAAAGAGCATTAAAATCGTAGATAA
GGGAGTATTAAAACACAGAAATTATTTGAATTATTACTGCAAAACAAAATTCAGTCAAAT
CCAAAACAAGCTACATATTAGAAGAAATCTCTTTTATAAATCTCATTTGAATAAGCAAAA
AAAGAACTTTAAAAAGAAGGGAATCAACAATCGTATTTCCAAGGAAACAGATATATCTAT
CTTATTTATTCATTTGAAGCGAGAGAATAAATTAGAAAAATTTAGAGATATTTATTTATT
AAAACTCCTTTTATTAAAATTTAGGGTACTTTACACACTCAACAAGCTCTTGAATACGGT
ACTAAGATGGTTGGTGGTGTCAATCCTGCTAAGGCTGGTCAAACCCACTTGGGCTTACCC
GTTTTCAAGAACTGCCAAGAAGCCAAGAAAGTCACCGGTTGTGATGCTTCCGTTATCTAC
GTTCCTCCCCCTCATGCTGCTAAGGCTATTATGGAAGCTATTGAAGCTGAAATTCCCTTG
GTCGTTGTCATCACCGATGGTATCCCATAACACGACATGGTCAAGGTTAAGCACGCTCTT
AGACAACAAAAGATTACCAGAATTATTGGTCCCAATTGCCCTGGTATCATTAAGCCCAAC
GAATGTAAGATTGGTATTATGCCCGGTTACATTCACAAGCCTGGTAAAATCGGTAAGCAA
ATTACTCTTAAATATTCACTCAAGCTATATTTTTAATTACCTTTCAGTTTGCACTTTGAT
TCTAAAAAAGAGAATGCTTAAGAAGTTTCGCATATTAATAGCTAACTGCATTTTTAATAA
TTCAAAATAATCTGAATATTCTGCCTTAATTTTATTAAATTAATTGAAGGAAAGAACTTA
AATAGATTAAATTGCTTAATAAAAAGTATCTTAAAAAAGACTATATCGTTTTTCTTTTTT
ACTTAAGATGTGTAGAAAACAATAGAACTATTTATATCTTTAAAAGAATACAAAAGAACA
TTATTTTTTAGACAAAAATTCAAAATAAAATAATAATAACAAATTAAATTAATAGATAAA
TAAATATACAAAAAACATCAAGCATATCTTAAATTTATTTATTTATTTTGTAGATAAGGT
GCAGATTGAAATAATTAAAATGAATGATTAAATTTAGTTTCTTCCTTACATAATTCTTAT
ATTTTATATAAAAGGTATCGTCTCAAGATCTGGTACTTTGACTTACGAAGCTGTTGACTA
AACTACTAAGGCTGGTTTGGGTCAATCTACCGTCGTTGGTATTGGTGGTGATCCTTTCAA
CGGTACCAATTTCATCGATGTCCTCGAAAGATTCGTTGAAGATCCCGAAACTGAAGGTAA
AAAAAAATAATAAAATTATATTAATTCAGCTTATTAAAAGATAGCATTATTATTTGGCAA
TAAGATTTAGAATATAGCAAAATTATAGAATATATAATGCTTTTAAAATAAATAATATTG
ATTAAACATATTATTTGTAAATTTACTTAAGAAATACTTTCTTAATAAAATGCTAAAAGA
TTTTACTAATTTTAGATTATTTATTTAAAAATTGTAATTAATTTTGAAAACTTGCTCACT
AATTGTTTTATAAAAAAAGGTATTTTATTAATTGGTGAAATCGGTGGTGAAGCTGAAGAA
CAAGCTGCTGCCTGGTTGAAGGCTAACAATAAAACCAACAAGCCCGTTGTTTCTTTCATT
GCTGGTGTTACTGCTCCTCCTGAGAGAAGAATGGGTCACGCTGGTGCTATCGTTTCTGGT
GGTAAGGGTTCTGCCACTGAAAAGATCAAGGCTTTAGAATCTGCTGGCATTAAGGTCTGC
AGATCTCCTGCCACCTTAGGTCAAGAAATGCTCAACCTCATGAAGGTCCATAAGAACTGA