Identifiers and Description

Gene Model Identifier

TTHERM_00532220

Standard Name

LRS2 (leucyl-tRNA synthetase 2)

Aliases

PreTt19880 | 68.m00169 | 3830.m00534

Description

leucyl-tRNA synthetase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00532220

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11827.19.997093137033517e-262leucyl-tRNA synthetase (883 aa
)
DictyBaseDDB_G02913469.997093137033517e-262mleuS on chromosome: 6 positio
n 154547 to 157369
OxytrichaContig2732.0.g19.997093137033517e-262tRNA synthetases class I (I, L
, M and V)
SGDYLR382C9.997093137033517e-262NAM2 Mitochondrial leucyl-tRNA
synthetase, also has a direct
role in splicing of several m
itochondrial group I introns;
indirectly required for mitoch
ondrial genome maintenance
WormBaseWBGene000030743.000551941601253e-121locus:lars-2 status:Confirme
d UniProt:G5EBH2 protein_i
d:CAE18063.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00532220(coding)
ATGTTAACGTAATCTATTAGAATTTTATCAAAACCGTTTTTAACAAATCAGTTAAGAACT
TAAAATTTATGTTTGAAGTTAAAAAACTACTTTTCACAGTATGAATTCTCATAAATTGAG
TAGAAGTGGCAGTAAAAATGGAATTAAAATATCCAATCTTCTCATAAAAAGATATCTGAT
ACTAATTAAGAAAAATATTATGTATTATCATAATTCCCATATCCAAGTGGAAATCTCCAC
ATGGGACACGCTAGGGTTTATTACATTTCTGACGTTATTTCCAGGTTTGAAAAAATGAAA
GGTAAAAATGTTATTAATCCTATGGGTTGGGATGCTTTTGGATTACCTGCAGAGAACGCT
GCCATATAAAGAAATATTGAACCTTCAGAATGGACCTATAAAAATATTTAACAAATGAAA
GAATAAATGATAAAATTGGGAGTTGTTTTCGATTGGGATTTAGAACTCTTCACATGCAGA
GAAGATTATTACAAGTGGACTTAATGGATTTTTATTTAACTTTTAAAGAATAAACTTGCT
TATAAGAAAGAAGCAGAGGTCAATTGGGATCCAATCGATTAGACAGTTTTAGCTAATGAA
TAAGTCGATGATTAGGGAAGATCGTGGAGAAGTGGAGCTAAGGTAGAAAAAAAAATGTTA
AATTAATGGTTTATTAAAACTACAGAATATGGAAAAGAACTCTTCTAGGATTTAAGTGAT
TTAGAAGGTTGGCCTTAGGCTGTTCAAGAAATGCAGAGAGGCTGGATAGGTTTTAGTGAG
GGAACTCAAATCAAATTTGAATTATTTTCCTAATAATAATAAAAATGTATTGATGAAATT
GAAGTCTACACAACTCGCCCTGATACAATTTATGGAGTTACTTTCTTAGCATTAGCTTAT
GATCACCAACTAGCTACAAAATTCTTAGCAGGATAAAAAGAGGAAGATCTAGCTGATTAT
GAAAAAATGAAAAACGAAATCAAATCTAGAAAGGATTTGGTTGTTAACAAAATTGGTTAT
AAAGTAAAAGATTATTATGCTGTTAACCCTTTGAGTGGCGAATAAGTTCCTATTTACCTT
GTAGACTATGTTTTGAAAGATTACGGGACTGGTGCAGTAATGGGTGTTCCTGCTCATGAT
GACAGAGACCAAGAATTTGCTAAAAAATACTAAATACCAATTAAAGAAGTCATAAAAGAA
GAAACAGACAACTAGTCAACAAAATAAGTTTTAGTCAATAGTGGAAAATTTAGCAATTTA
GAAATTGCAGAAGCTAAGAAATAGATTAACGAATAATTAATTCAAATTGGAAAAGGCCAT
GTAACATCTAATACTAGCATGAGAGATTGGCTAGTATCTAGATAAAGATATTGGGGAGTT
CCTATCCCTGTGATTGAATGTCCTACTTGTGGAGTTTTACCTGTCCCTGAAGATCAACTT
CCTGTTATTTTACCAGAAAAATTAGGAAATCCTGTTTAATTGAAAAATGGAAATCCATTA
GCTCATATTAAAGATTTTGTGGAGTGTAAATGCCATATTTGTGGTAACAACAAGGCAAAA
AGAGAAACTGATACACTTGATACATTTGTTGATTCTAGTTGGTATTTTTTAAGATTTCCA
GACAGCAAAAATTCGCTCTAAATATTTGATAGCAATCTAATTAAATATTGGGCTCCTGTT
GATTTGTATATTGGAGGTATGGAGCATGCTATTTTACATCTTTTGTATGCTCGTTTTATT
CATAAATTTTTGCACAAACAACAATTTGTACCATTACATAAAGAACCATTCAAGTAGTTA
ATTGTCTAAGGTTTGGTTAAAAGTAAAAGCTATAGATTGAAATAAACAGGATAATACCTC
TATCCTTAGGAAGCTTAAAAATACGCTGAAGATGAATTAGACATTAAAATAGAAAAAATG
TCCAAATCCAAAAATAATGGAGTAAATCCGCTCGAAGAAATTGAAAAGTTTGGAGCTGAC
TGTTTAAGAATGACTTTACTCTTTTATGGACCTAATGAAAAGGATATTGCTTGGGATGGC
AACCTTTAAAAAACGCTGTACTCTTATCTCAATAAGGTGTGGAATTTACACTTGAAAATA
CAGTCGGCTTATAAAAATGATGGTGATTTGCTCAAAAAAATGAACAAATAAGAAAAAATT
TCCACTTTCAAAAAAGTGTATGGATATGTCGAAAATATTCAAAATGCATTAGAAAGAAAA
GATCGTTCTTTCCATGTTGCTATTGCTAGATAAATGGAATTGTATAATTTCTTAAGTGAA
TTGCAAGAATAGTCAGGAATCACATAGGAATTTTCTGAAATTTACGAGTATTTAATCAAT
TCCTTGTATCCATTTGCCCCTCACACTATGAGTGAAATAGCCGAAAATCTTTATAAAAAA
GAATATTAATTTGTATGGCCTGATTTATTAGCTATTAAGAATAAGCATTTGAATGAAGAT
ACTATCTCAGTTAAAATTAATGTTAACAATAAATTTAAAGGATAGCTAGAAATTGAATCT
TCATTTATGGATTCATAAAATGACGAACAAATAATTAAAGCAATAAATGAAAGCCTAAAG
CTTAATATAAGCTAATATAAAAACATAATAAAAATTAACAGAAAAAATGCATTTGTAATA
AATGTCATTTAGTGA


>TTHERM_00532220(protein)
MLTQSIRILSKPFLTNQLRTQNLCLKLKNYFSQYEFSQIEQKWQQKWNQNIQSSHKKISD
TNQEKYYVLSQFPYPSGNLHMGHARVYYISDVISRFEKMKGKNVINPMGWDAFGLPAENA
AIQRNIEPSEWTYKNIQQMKEQMIKLGVVFDWDLELFTCREDYYKWTQWIFIQLLKNKLA
YKKEAEVNWDPIDQTVLANEQVDDQGRSWRSGAKVEKKMLNQWFIKTTEYGKELFQDLSD
LEGWPQAVQEMQRGWIGFSEGTQIKFELFSQQQQKCIDEIEVYTTRPDTIYGVTFLALAY
DHQLATKFLAGQKEEDLADYEKMKNEIKSRKDLVVNKIGYKVKDYYAVNPLSGEQVPIYL
VDYVLKDYGTGAVMGVPAHDDRDQEFAKKYQIPIKEVIKEETDNQSTKQVLVNSGKFSNL
EIAEAKKQINEQLIQIGKGHVTSNTSMRDWLVSRQRYWGVPIPVIECPTCGVLPVPEDQL
PVILPEKLGNPVQLKNGNPLAHIKDFVECKCHICGNNKAKRETDTLDTFVDSSWYFLRFP
DSKNSLQIFDSNLIKYWAPVDLYIGGMEHAILHLLYARFIHKFLHKQQFVPLHKEPFKQL
IVQGLVKSKSYRLKQTGQYLYPQEAQKYAEDELDIKIEKMSKSKNNGVNPLEEIEKFGAD
CLRMTLLFYGPNEKDIAWDGNLQKTLYSYLNKVWNLHLKIQSAYKNDGDLLKKMNKQEKI
STFKKVYGYVENIQNALERKDRSFHVAIARQMELYNFLSELQEQSGITQEFSEIYEYLIN
SLYPFAPHTMSEIAENLYKKEYQFVWPDLLAIKNKHLNEDTISVKINVNNKFKGQLEIES
SFMDSQNDEQIIKAINESLKLNISQYKNIIKINRKNAFVINVIQ


>TTHERM_00532220(gene)
ATGTTAACGTAATCTATTAGAATTTTATCAAAACCGTTTTTAACAAATCAGTTAAGAACT
TAAAATTTATGTTTGAAGTTAAAAAACTACTTTTCACAGTATGAATTCTCATAAATTGAG
TAGAAGTGGCAGTAAAAATGGAATTAAAATATCCAATCTTCTCATAAAAAGATATCTGAT
ACTAATTAAGAAAAATATTATGTATTATCATAATTCCCATATCCAAGTGGAAATCTCCAC
ATGGGACACGCTAGGGTTTATTACATTTCTGACGTTATTTCCAGGTTTGAAAAAATGAAA
GGTAAGACTTTATTTGGAAGGTTTTAGTGAAATCTTCATCTGTTTTTTCTTGCTTCATAT
CTTTACTGTATTTTTTAAATGTCATTTAGAATTATCTCAAAAAATTTATTTTTATCTAGG
TAAAAATGTTATTAATCCTATGGGTTGGGATGCTTTTGGATTACCTGCAGAGAACGCTGC
CATATAAAGAAATATTGGTAGATTTAAGATTGATTAATAATTTTATTTTACATTTTTATT
CAATAAAACATCACTAATATTTGATAGTAATAAAATCTACTTATTAAATTTAAAGAACCT
TCAGAATGGACCTATAAAAATATTTAACAAATGAAAGAATAAATGATAAAATTGGGAGTT
GTTTTCGATTGGGATTTAGAAGTATTTAATAATACATAAATTTGATTTTACAGTTATTTT
ATAAATTTAAAAGCTCTTCACATGCAGAGAAGATTATTACAAGTGGACTTAATGGATTTT
TATTTAACTTTTAAAGAATAAACTTGCTTATAAGAAAGAAGCAGAGGTCAATTGGGATCC
AATCGATTAGACAGTTTTAGCTAATGAATAAGTAAGTACATTTATTTAGTAATTTAAATT
ATTACAAAAATAACTTAATTAGATTTTCGAAATAATTTAATTAAATAAACAAATTAACTA
ATTAAACTAATTTTTATAGATAATTAATTATTTATTTACAAAATTCATATTAATTTTCAT
AATCAAAATTTACAAATATATAATTAAAATATTTTTGAATGCTAATTATAAAAAATTTTT
TTCAATCTCACTGATTTTTCCAAATTACACCAAAATTTTTGAATAGGATCATTTTAATTA
CATTTGTTTTTGTAGAATTAAAATATAATAATCAAAAAATTATACTTTCAAAAAAATAAA
TATCATGTCATTTTTGCAGAATTAGATAGTAAATCATGTTACTGCTTTTTTTTTATCAAA
ATACAATTAATTATTTAATAAACTTACTTAATAATAAAGACAGTTTATTTATCTTACAAG
CAGATATTTATTTGCATTAAAATAGTGAGGTTTTATTACGCTATTGATATTTATTATTTG
TTTAGTAATTCAATCAACACACAGATTAAAAATTATGTTTAGTTTTAAACATGTAAAAAT
TATTATTTTTCTTTTTTAGGTCGATGATTAGGGAAGATCGTGGAGAAGTGGAGCTAAGGT
AGAAAAAAAAATGTTAAATTAATGGTTTATTAAAACTACAGAATATGGAAAAGAACTCTT
CTAGGATTTAAGTGATTTAGAAGGTTGGCCTTAGGCTGTTCAAGAAATGCAGAGAGGCTG
GATAGGTTTTAGTGAGGGAACTCAAATCAAATTTGAATTATTTTCCTAATAATAATAAAA
ATGTATTGATGAAATTGAAGTCTACACAACTCGCCCTGATACAATTTATGGAGTTACTTT
CTTAGCATTAGCTTATGATCACCAACTAGCTACAGTAAAATTAATGAATGAAATTTCAAT
TTTTACTATTTAATTTTCAAATTAACTTGTTTGTTTGAAGTAAATTCTTTATTTTTAAAG
TCAACTAATTTGATTATAAAAAGAAATTCTTAGCAGGATAAAAAGAGGAAGATCTAGCTG
ATTATGAAAAAATGAAAAACGAAATCAAATCTAGAAAGGATTTGGTTGTTAACAAAATTG
GTTATAAAGTAAAAGATTATTATGCTGTTAACCCTTTGAGTGGCGAATAAGTTCCTATTT
ACCTTGTAGACTATGTTTTGAAAGATTACGGGACTGGTGCAGTAATGGGTGTTCCTGCTC
ATGATGACAGAGACCAAGAATTTGCTAAAAAATACTAAATACCAATTAAAGAAGTCATAA
AAGAAGAAACAGACAACTAGTCAACAAAATAAGTTTTAGTCAATAGTGGAAAATTTAGCA
ATTTAGAAATTGCAGAAGCTAAGAAATAGATTAACGAATAATTAATTCAAATTGGAAAAG
GCCATGTAACATCTAATACTAGCATGAGAGTAAAATTTTATTTTTATAAATATACTGATA
TAACTTTTTTTTTCTTCTTCTCAGGATTGGCTAGTATCTAGATAAAGATATTGGGGAGTT
CCTATCCCTGTGATTGAATGTCCTACTTGTGGAGTTTTACCTGTCCCTGAAGATCAACTT
CCTGTTATTTTACCAGAAAAATTAGGAAATCCTGTTTAATTGTAGTTAATAAAAATAAAA
ATTCAAAATTATATTTTTTTTTGTATTTCTGAATTAATATTTAGGAAAAATGGAAATCCA
TTAGCTCATATTAAAGATTTTGTGGAGTGTAAATGCCATATTTGTGGTAACAACAAGGCA
AAAAGAGAAACTGATACACTTGATACATTTGTTGATTCTAGTTGGTATTTTTTAAGATTT
CCAGACAGCAAAAATTCGCTCTAAGTAAATATATTTAATTTAATATTAAAATGTTACTCA
TTACAATTTTTATTATTATAAATTACATTTAAAAAAATCTAATTTTAGGTTGAATATAAC
TGTAATCAGCCTAAATTTTTAAAGATACAATATTTTTGTATGAATCTCAAAAGAATCATA
TGATTTTTAATTTTATTAATTTTACCCTGAGTGTTTAATATTTTTAATTACTTTTTTCTC
CAATAATATGAAAAGATATTTGATAGCAATCTAATTAAATATTGGGCTCCTGTTGATTTG
TATATTGGAGGTATGGAGCATGCTATTTTACATCTTTTGTATGCTCGTTTTATTCATAAA
TTTTTGCACAAACAACAATTTGTACCATTACATAAAGAACCATTCAAGTAGTTAATTGTC
TAAGGTTTGGTTAAAAGTAAAAGCTATAGATTGAAATAAACAGGATAATACCTCTATCCT
TAGGAAGCTTAAAAATACGCTGAAGATGAATTAGACATTAAAATAGAAAAAATGTCCAAA
TCCAAAAATAATGGAGTAAATCCGCTCGAAGAAATTGAAAAGTTTGGAGCTGACTGTTTA
AGAATGACTTTACTCTTTTATGGACCTAATGAAAAGGATATTGCTTGGGATGGCAACCTT
TAAAAAACGCTGGTAAGTATTTTAAGAAAATACATCTAATAAAAGAATAATTAAATTATA
TACAGTACTCTTATCTCAATAAGGTGTGGAATTTACACTTGAAAATACAGTCGGCTTATA
AAAATGATGGTGATTTGCTCAAAAAAATGAACAAATGTAATTTGTTGCAAATTAAAATAT
TTACCATTCATTAATTTTATATTCCTTAATTAACATTACAGAAGAAAAAATTTCCACTTT
CAAAAAAGTGTATGGATATGTCGAAAATATTCAAAATGCATTAGAAAGAAAAGATCGTTC
TTTCCATGTTGCTATTGCTAGATAAATGGAATTGTATAATTTCTTAAGTGAATTGCAAGA
ATAGTCAGGAATCACATAGGAATTTTCTGAAATTTACGAGTATTTAATCAATTCCTTGTA
TCCATTTGCCCCTCACACTATGAGTGAAATAGCCGAAAATCTTTATAAAAAAGAATATTA
ATTTGTATGGCCTGATTTATTAGCTATTAAGAATAAGCATTTGAATGAAGATACTATCTC
AGTTAAAATTAATGTAAATATTAATTCATGAATTGTTAAGCTAACATTTATAATTTTATC
TAACAATTAATTAGGTTAACAATAAATTTAAAGGATAGCTAGAAATTGAATCTTCATTTA
TGGATTCATAAAATGACGAACAAATAATTAAAGCAATAAATGAAAGCCTAAAGCTTAATA
TAAGCTAATATAAAAACATAATAAAAATTAACAGAAAAAATGCATTTGTAATAAATGTCA
TTTAGTGA