Identifiers and Description

Gene Model Identifier

TTHERM_00670340

Standard Name

LRS1 ( leucyl-tRNA synthetase 1)

Aliases

PreTt01058 | 100.m00119 | 3731.m00029

Description

leucyl-tRNA synthetase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00670340

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_224850
WormBaseWBGene000030739.997093137033517e-262locus:lars-1 Leucine--tRNA l
igase status:Confirmed Uni
Prot:Q09996 protein_id:CAA85
280.1
Tetrahymena borealisEI9_16448.19.997093137033517e-262leucyl-tRNA synthetase (1078 a
a)
DictyBaseDDB_G02854519.997093137033517e-262leuS on chromosome: 4 position
3240792 to 3244287
OxytrichaContig579.1.g579.997093137033517e-262tRNA synthetases class I (I, L
, M and V)
SGDYPL160W9.997093137033517e-262CDC60 Cytosolic leucyl tRNA sy
nthetase, ligates leucine to t
he appropriate tRNA

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00670340(coding)
ATGTGTATATTTGGAAAATTATATTTCAAACTATAAAAATTAAACAGTTCATAATTTAAG
ATATTTTTGCAAAAAATTAGATAAAGTTTTAGTACACTAAATTAATAAATGGAAGATAAA
CCTAAATAAAACTTCGCAAGAAGAGATCGTTTAGTCGAACTTGAAAAGTAAGCCTAAAAG
AAATGGGAAGATGAAAAGACTTATGAATCTAACCCTAATCCTGGATAAAAGAAGTACTTG
GTTACTTTCCCTTATCCTTATTTGAATGGTAGATTGCATTTGGGACACAGCTATACCATG
ACTAAAGTTGATTTCATTGCTCGTTATAAGCGTCTTAATGGATTTAATGTCGTTTTCCCC
TTCGGTTTCCATTGCACCGGTTAGCCTATTTCTGCTGCTGCCACCAAGCTTAGAAGAGAA
ATAGAAGAATATGGTCTTCCTCCAGTTTTCCCCGAAGAAAAGAAGGAGCAAAGACAATGG
AATATCCTCAAGAAGATGGGTATCCCTGATGAAGACATTCCTAAATTCTAAGAAGGTAAA
TTCTGGTGTGGTTATTTCCATCCTTTTGCCACTTAAGATTTGAAGTCTTTTGGTGTTGCT
GTTGATCACAGAAGATCCTTTATTACTACTGATGTTAATCCTTACTATGACTCATTCATT
CAATGGTAGTTCACTCTTTTGAAAGAAAGAAACTATATTCGTTATGGTAAGAGACCTTCC
ATTTTCTCCGTCGCAGATAATCAAATTTGTGCTGATCACGACAGAGCTTAAGAATCTGAA
GGTATTGGTCCATAAGAATACACTCTTATTAAGTTGAAGGTTCTCGAATTCCACGGAGCT
TTGAAGGCTCTTGAAGGCAGAAACGTTTACTTGGCTGCTGCTACTTTGAGACCTGAAACT
ATGTATGGTTAAACTAACTGTTACATTCTTCCTGATGGTGTTTATGGTGCTTTTGAAGTC
ACTAATGATGAAGTCTTTATTGTTGCTGAAAGAGCTGCTAAGAATATGGCTTACTAAGAT
TTGACTAAAGAATATGGTAAATATGTTAAAATTATGGATATTAAGGGTACTGATTTGTTG
GGCATTCCTTTGAAGGCTCCTCTTTCCACCTACGAAAAGGTTTATGCTCTCCCTATGCTT
ACTATTTCTATGGAAAAGGGTACTGGTGTTGTTACTTCAGTTCCTTCTGACTCTCCTGAT
GACTATGCTGCTCTTAGAGATTTGAAGAACAAGGCTCCTCTTAGAGAAAAGTATGGAATC
AAAGAAGAACACGTATTGCCATTTGAACCTGTTCCTATCATTAACATTCCTGAATTGGGA
GATCTTGCTGCTATTGTTGCTTGTGAAAAGCATAAAGTAGCCTCTCAAAATGATAAAGAA
AATCTTAAAAATGCTAAGGATGAGTGTTACTTGAAGGGTTTCTATGATGGTGTTATGAAA
GTTGGTAAGTACGCAGGTGTTAAGGTTTAAGACGCTAAGAATTTGGTAAAGAATGATATG
TTAGCCTCTGGTGAAGCCGCTAAGTACTGGGAACCTGAAGGAAAGGTCATTTCCAGATCT
GGTGATGAATGTATTGTTGCCCTCATGGACTAATGGTATCTTGCTTACGATGAAGAAGAA
TGGAAGAAACCAGTTAGAGATCATGTTAAAAATGTATTCAATTGTTACAACGATATCGTT
CACAAGAGCTTCATTGCTACTGTTGAATGGTTGTAACAATGGGGTTGTTCTCGTTCTTTT
GGTCTTGGTAGTTACCTTCCTTTTGATAAGAACTATCTCGTTGAATCTCTTTCTGATTCC
ACCATCTACATGGCTTATTACACTGTTGTTCACTTGTTACAAGGAAACGTTGTTGGTTCT
CAAGCAGGTCCTCTAGGAATTAACCCTGATTAGATGAACAGAGAATTCTGGGACTACGTA
TTCTTGAATGCTCCTTATTCTGATAAGATTAAAGTTGAAGAAGAAAAGATTAAACAACTT
AGAGAATCCTTTAGATATTGGTATCCTCTTGATTTGAGAGGATCTGCTAAGGATTTGGTT
AAGAACCACTTGACCATGTGTATTTTCAACCATGCTGCCATTTGGAAAGATGAACCTAAC
ATGTGGCCTCGTTCATTCTTTGTTAATGGATATATGCTTGTTGATGGTGAAAAAATGTCC
AAGTAAAAGGGTAACTTCTTTACATTGAAGGATATCGTCTCAATGTACGGTGCTGATGCT
TGCCGTTTTGCTTTATCTGAAGCCGGTGACACCCAAGATGATGCTAACTTCGAAAAGCAA
GTTGCTGATAACTCAATTCTTAAAATTTCTACTTTGGAAATGTGGTTAAAGGAATACATT
GCTAACCATCAAAATAGTAGAACTGAAAGCCCCAATGAAAATATTACTTTCTTCGATAAG
GTCTTCGAAAATTAAATTAAGAATCTCTATGTCAACTGTATAAAATCTTATGAAGATATG
CGTTTCAGAGATGTTGCTAAATTCGGCTTCCACGAATTCGGTACAATCAAAGAAGAATAT
CTTATCAATTGTGGTACTTTTGGACCTCGTAAGGACCTTATCCTTACCTGGATTTAATAT
CAACTTTTGATTATGTATCCCATCATTCCTCACTTCTGTGAAATGGCTTGGGTTATTTAC
TTCCTTCCTCTTGTTAACAACAGTGCATAATATCCTGCTACTCTTTCCCAAGCAACTTTA
CCTGAAGTTAACGCTGCCAGTATTGATGCCATCACTATCCGTGCCTACAATTGCTTATAA
TCTTTCTTGAGAAATCTCCGTGTTACTTATAAGAAATCTACTCAAACTAAGAAGGGTGCC
AAGGATGTCACTTTCACAAAGGTTACTGTTATTTATGCTCCTAAGTATCCTGATTGGTAA
CAATATGTCTTAAATATCTTGAATGAACAACTCGAAGGAAACAAGATCAAGGATGCTTGG
AAGGTCATCCTTAAGGAGAAGATTACTGATAAGAATCTCTTAAGTAAATCATTGCAATTT
GCATCTTTTGTTACCAAGGAATTCGAATAAGCAGGAAAAGAAGTTCTTGAATCTACTCTT
CCTTTCAACGAAATTTAACTCTTATAAGACAATAAGCACTTGATCCAAAAGGAACTCAAA
ATCGAAGATGTTAATTTCATTTCTGTAGATCAAGCTGAAAGTCTTAAGGACAAGACTTAC
GCACAAGCTCTTCAATCTTGTGTTCCAGGCAAGGCTCAAGTCGTTTTTGCTTGA


>TTHERM_00670340(protein)
MCIFGKLYFKLQKLNSSQFKIFLQKIRQSFSTLNQQMEDKPKQNFARRDRLVELEKQAQK
KWEDEKTYESNPNPGQKKYLVTFPYPYLNGRLHLGHSYTMTKVDFIARYKRLNGFNVVFP
FGFHCTGQPISAAATKLRREIEEYGLPPVFPEEKKEQRQWNILKKMGIPDEDIPKFQEGK
FWCGYFHPFATQDLKSFGVAVDHRRSFITTDVNPYYDSFIQWQFTLLKERNYIRYGKRPS
IFSVADNQICADHDRAQESEGIGPQEYTLIKLKVLEFHGALKALEGRNVYLAAATLRPET
MYGQTNCYILPDGVYGAFEVTNDEVFIVAERAAKNMAYQDLTKEYGKYVKIMDIKGTDLL
GIPLKAPLSTYEKVYALPMLTISMEKGTGVVTSVPSDSPDDYAALRDLKNKAPLREKYGI
KEEHVLPFEPVPIINIPELGDLAAIVACEKHKVASQNDKENLKNAKDECYLKGFYDGVMK
VGKYAGVKVQDAKNLVKNDMLASGEAAKYWEPEGKVISRSGDECIVALMDQWYLAYDEEE
WKKPVRDHVKNVFNCYNDIVHKSFIATVEWLQQWGCSRSFGLGSYLPFDKNYLVESLSDS
TIYMAYYTVVHLLQGNVVGSQAGPLGINPDQMNREFWDYVFLNAPYSDKIKVEEEKIKQL
RESFRYWYPLDLRGSAKDLVKNHLTMCIFNHAAIWKDEPNMWPRSFFVNGYMLVDGEKMS
KQKGNFFTLKDIVSMYGADACRFALSEAGDTQDDANFEKQVADNSILKISTLEMWLKEYI
ANHQNSRTESPNENITFFDKVFENQIKNLYVNCIKSYEDMRFRDVAKFGFHEFGTIKEEY
LINCGTFGPRKDLILTWIQYQLLIMYPIIPHFCEMAWVIYFLPLVNNSAQYPATLSQATL
PEVNAASIDAITIRAYNCLQSFLRNLRVTYKKSTQTKKGAKDVTFTKVTVIYAPKYPDWQ
QYVLNILNEQLEGNKIKDAWKVILKEKITDKNLLSKSLQFASFVTKEFEQAGKEVLESTL
PFNEIQLLQDNKHLIQKELKIEDVNFISVDQAESLKDKTYAQALQSCVPGKAQVVFA


>TTHERM_00670340(gene)
ATATTTTTAATTTATTTAAAAATTATGTGTATATTTGGAAAATTATATTTCAAACTATAA
AAATTAAACAGTTCATAATTTAAGATATTTTTGCAAAAAATTAGATAAAGTTTTAGTACA
CTAAATTAATAAATGGAAGATAAACCTAAATAAAACTTCGCAAGAAGAGATCGTTTAGTC
GAACTTGAAAAGTAAGCCTAAAAGAAATGGGAAGATGAAAAGACTTATGAATCTAACCCT
AATCCTGGATAAAAGAAGTACTTGGTTACTTTCCCTTATCCTTATTTGAATGGTAGATTG
CATTTGGGACACAGCTATACCATGACTAAAGTTGATTTCATTGCTCGTTATAAGCGTCTT
AATGGATTTAATGTCGTTTTCCCCTTCGGTTTCCATTGCACCGGTTAGCCTATTTCTGCT
GCTGCCACCAAGCTTAGAAGAGAAATAGAAGAATATGGTCTTCCTCCAGTTTTCCCCGAA
GAAAAGAAGGAGCAAAGACAATGGAATATCCTCAAGAAGATGGGTATCCCTGATGAAGTA
ATTTTTTAATTTTCCTAATATAAAAATAAGCAAAAAACTAGCAAATTTATGCTTTCAAAG
ATAGATCTTAACTAAGCATTGTTGAATAGCTATCTTCCCATGAAAAAAGCAAAATAAATA
AATCCTTCGCTAAAATATTTCAATAAATCAGAAGAAAAGCACTAACAAGCAGATACATTA
TTATTGACTGATTAGGCTGAATTTCACTAAATACATTAAAATGAAATTTAATTAATTATT
AACTAATTCAATTTTTAAAACAGGACATTCCTAAATTCTAAGAAGGTAAATTCTGGTGTG
GTTATTTCCATCCTTTTGCCACTTAAGATTTGAAGTCTTTTGGTGTTGCTGTTGATCACA
GAAGATCCTTTATTACTACTGATGTTAATCCTTACTATGACTCATTCATTCAATGGTAGT
TCACTCTTTTGAAAGAAAGAAACTATATTCGTTATGGTAAGAGACCTTCCATTTTCTCCG
TCGCAGATAATCAAATTTGTGCTGATCACGACAGAGCTTAAGAATCTGAAGGTATTGGTC
CATAAGAATACACTCTTATTAAGTTGAAGGTAAAAAAATAGAATCTTATCTAAAATTTTT
TAATCTAAAATAAATCTCTTTTTTTAAAAAGATATCTTATTATATCAATATAAACATTAA
AACCTATTCAATACATTTTATCAATTAATTACCACAACATAATTCGTCCACTTATAGAAT
ACCCCTTTAGCAAAACTCAATAAAATATTTTTTTTTTTCATAATAGGTTCTCGAATTCCA
CGGAGCTTTGAAGGCTCTTGAAGGCAGAAACGTTTACTTGGCTGCTGCTACTTTGAGACC
TGAAACTATGTATGGTTAAACTAACTGTTACATTCTTCCTGATGGTGTTTATGGTGCTTT
TGAAGTCACTAATGATGAAGTATATATTTTATTAATATTGTTTTTTTACTTATCTATCAA
TCTTTGGTTAATTATTTAGCCAAAATTTATAATCATATTTATGATAATTTATCCTTATTT
TTAAGTGATTTAAATAATGAAATGTATTTAATAGGTCTTTATTGTTGCTGAAAGAGCTGC
TAAGAATATGGCTTACTAAGATTTGACTAAAGAATATGGTAAATATGTTAAAATTATGGA
TATTAAGGGTACTGATTTGTTGGGCATTCCTTTGAAGGCTCCTCTTTCCACCTACGAAAA
GGTTTATGCTCTCCCTATGCTTACTATTTCTATGGAAAAGGGTACTGGTGTTGTTACTTC
AGTTCCTTCTGACTCTCCTGATGACTATGCTGCTCTTAGAGATTTGAAGAACAAGGCTCC
TCTTAGAGAAAAGTATGGAATCAAAGAAGAACACGTATTGCCATTTGAACCTGTTCCTAT
CATTAACATTCCTGAATTGGGAGATCTTGCTGCTATTGTTGCTTGTGAAAAGCATAAAGT
AGCCTCTCAAAATGATAAAGAAAATCTTAAAAATGCTAAGGATGAGTGTTACTTGAAGGG
TTTCTATGATGGTGTTATGAAAGTTGGTAAGTACGCAGGTGTTAAGGTTTAAGACGCTAA
GAATTTGGTAAAGAATGATATGTTAGCCTCTGGTGAAGCCGCTAAGTACTGGGAACCTGA
AGGAAAGGTCATTTCCAGATCTGGTGATGAATGTATTGTTGCCCTCATGGACTAATGGTA
TCTTGCTTACGATGAAGAAGAATGGAAGAAACCAGTTAGAGATCATGTTAAAAATGTATT
CAATTGTTACAACGATATCGTTCACAAGAGCTTCATTGCTACTGTTGAATGGTTGTAACA
ATGGGGTTGTTCTCGTTCTTTTGGTCTTGGTAGTTACCTTCCTTTTGATAAGAACTATCT
CGTTGAATCTCTTTCTGATTCCACCATCTACATGGCTTATTACACTGTTGTTCACTTGTT
ACAAGGTATTTATTTATTTATTTTTTTCATTTTTTTCATTAAATTTATTATTTTTAAAAC
TAAATTCATTATTTTTATTCAAAAGGAAACGTTGTTGGTTCTCAAGCAGGTCCTCTAGGA
ATTAACCCTGATTAGATGAACAGAGAATTCTGGGACTACGTATTCTTGAATGCTCCTTAT
TCTGATAAGATTAAAGTTGAAGAAGAAAAGATTAAACAACTTAGAGAATCCTTTAGATAT
TGGTATCCTCTTGATTTGAGAGGATCTGCTAAGGATTTGGTTAAGAACCACTTGACCATG
TGTATTTTCAACCATGCTGCCATTTGGAAAGATGAACCTAACATGTGGCCTCGTTCATTC
TTTGTTAATGGGTAAATAATTATTTTGCTTTAATTTTTTTATTTCCTCTATTTTCATAAA
TTAATTGATGAACATTTGCTTAATCATAATAATAGATATATGCTTGTTGATGGTGAAAAA
ATGTCCAAGTAAAAGGGTAACTTCTTTACATTGAAGGATATCGTCTCAATGTACGGTGCT
GATGCTTGCCGTTTTGCTTTATCTGAAGCCGGTGACACCCAAGATGATGCTAACTTCGAA
AAGCAAGTTGCTGATAACTCAATTCTTAAAATTTCTACTTTGGAAATGTGGTTAAAGGAA
TACATTGCTAACCATCAAAATAGTAGAACTGAAAGCCCCAATGAAAATATTACTTTCTTC
GATAAGGTCTTCGAAAATTAAATTAAGAATCTCTATGTCAACTGTATAAAATCTTATGAA
GATATGCGTTTCAGAGATGTTGCTAAATTCGGCTTCCACGAATTCGGTACAATCAAAGAA
GAATATCTTATCAATTGTGGTACTTTTGGACCTCGTAAGGACCTTATCCTTACCTGGATT
TAATATCAACTTTTGATTATGTATCCCATCATTCCTCACTTCTGTGAAATGGCTTGGGTT
ATTTACTTCCTTCCTCTTGTTAACAACAGTGCATAATATCCTGCTACTCTTTCCCAAGCA
ACTTTACCTGAAGTTAACGCTGCCAGTATTGATGCCATCACTATCCGTGCCTACAATTGC
TTATAATCTTTCTTGAGAAATCTCCGTGTTACTTATAAGAAATCTACTCAAACTAAGAAG
GGTGCCAAGGATGTCACTTTCACAAAGGTTACTGTTATTTATGCTCCTAAGTATCCTGAT
TGGTAACAATATGTAACATATTTTTAAAAATATTTTCAAAAAGTAGAGTTAAATATTTTA
TATTTATTCATTAAAAGGTCTTAAATATCTTGAATGAACAACTCGAAGGAAACAAGATCA
AGGATGCTTGGAAGGTCATCCTTAAGGAGAAGATTACTGATAAGAATCTCTTAAGTAAAT
CATTGCAATTTGCATCTTTTGTTACCAAGGAATTCGAATAAGCAGGAAAAGAAGTTCTTG
AATCTACTCTTCCTTTCAACGAAATTTAACTCTTATAAGACAATAAGCACTTGATCCAAA
AGGAACTCAAAATCGAAGATGTTAATGTAATTAAATCAATAATGAGTAGCATAAATTAAA
TTATTACTTTTAATTAAAATAGTTCATTTCTGTAGATCAAGCTGAAAGTCTTAAGGACAA
GACTTACGCACAAGCTCTTCAATCTTGTGTTCCAGGCAAGGCTCAAGTCGTTTTTGCTTG
AAAACTTTAACAAAAAATTTATAATTTAAAATTAAATATTTTTATTTAAAATAAACAATT
AAATGTCCGATTTTTATTGCCTGTTTACTTATTTTTTAAAACTAT