Identifiers and Description

Gene Model Identifier

TTHERM_00371100

Standard Name

LRR5 (Leucine Rich Repeat family protein 5)

Aliases

PreTt28626 | 39.m00199 | 3693.m00046

Description

Leucine Rich Repeat family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00371100

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12260.19.997093137033517e-262leucine rich repeat family pro
tein (1120 aa)
OxytrichaContig1198.1.g791.0002758036576784e-62Leucine Rich repeat
Stentor CoeruleusSteCoe_199332.9374821117108028e-30
DictyBaseDDB_G02923860.0000000400154582995175carmil on chromosome: 6 positi
on 1735919 to 1739473

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00371100(coding)
ATGGGTTTTGAAACTGGCAAATAACTATTAAAAGGAAGACATCACAATAGTGCTAGCAAC
GCAACAGAATTTTATGCATCAGGTTTTCACGATGATTAAGAATCCATATTAATGTCTGTA
TTAGATGATTCTTAAATGGATCAAATCACGGCTGCAGTATACTAAAGTTACAATGACTCC
ACGATGAACAGCAGCTATAAGCATCCATTTATGACAGAAATATAATAAAACCTTGATACT
TCAGCTAATCTTAGTCTAAAATAAGTACTTGTTCATAGCGAAAAAAAGTTTAATTTGAAG
GAAGAGAGAAAGATGTAGCATTTTACTAATAAGTTACCCAGTATAAATGCCTCTGATGAT
TTATAAATAAACTCGATGAATTCTTTTGGCTCATAAGGTTTGATAAAAAGTAGTAAAATG
TCGCAAAAGTACATAAATTAGATGAGCAGAGAAGATTTGCCCTCTCGTTTTTCTATTGAT
CCAGAGTAATATCTATAAAACGAATAAGAAATCCCTCTCCTTCCAAATGAATAAAGAGAA
TGGTTTTTACCACAGTTAAAAAAAAATGGAGTTTAACTGAAGACAGAAAAAGAAATATTT
TACTAATAGTATAAAAAGTTGAGTAAAATTACATAGTATGACAAGAGATATAAAACAAAT
AAGTTCATTTATAAATCGATGTGCCAAAAAGCAGAAGAGTGTAATTTACTACCTAAGACT
TTTGAAATTTTCAAATCAAATTCTTGTGTTCATAAAGAGCTAAATCTAAATAACTATGGC
ATAGGAGAATAATATTGTAAAGTTTTTTCTGAGGCTCTTTAGGTTGAAGACTTGCAACAT
TTAAAAAAATTAAAAATATCATAAAACAATTTAAGAGGTGGGTCGCTTAATAAAATATTT
AAATCTTGCGCTTCCAAAATGAAAGTGTTAGATATTTCAGGTAATTCGGTTCGATAAGAA
GATTTGGCTACTTTTAAACCTCTGTTTGCAAGAACAACACTAGCTTTTTTAAATATTGCT
TAATGCAGAATTGGTGATACTGGCTTTACAGAATTATACTAAAACATCAAAGAAAATTAG
CACTTAAAAGTTTTAAATATAAGCATGAATAATTTGACAGAGATAAGTGCTGAAAAATTA
AAAAAGCTTTTGACTTACAATACTAGCTTATAAGAGTTGTATTTGCACTGGAATAATTTC
AAAAATGAAGGAGGATGTGAAATTTTAAAAGGAGTTTTAGAAAATTCTTATTTGAAGGTG
TTTGATATATCATATAACTCTCTGAAATACTAAGGCGATTTAAACGAATAAAATCAGCAA
AAAGCAGCTGCTTATTATATTGCTCAAATACTTTCTAAAGAAACTTCAGAGTTACTTCAT
TTAGATGTGTCTTATAATAATTTTTCTCCAACAGAATGTAAAATGATTTAAGAAAGCCTA
TTCTACAATAGTTGGCTTTTTGGACTTCATTTTGAAGGAAATTCAAATTATGTTGTTGAC
TCAAGTGGCTTTATTGTTGAACTTTAAAATGGTTTTCGCCCAAGAATGCAGCACAAACGA
TAGATTAAATCAATTCATTAAATTCCGTTTTTTTAAGAAGACGAGTTATGGGATTCAGAT
TAATAGTAATTATAAGACATTTGTTGGATATGTTAAGGATGGCAAGAAGTGATCATTTAA
GCAAAGGATATCTAGGAAGAACCACTCTACTTGCACTTAAGTTATTAAAACTTTAAACCT
GAGCTACTCAAAAAGAATGAAGAAGGACACTACATAAAATCTTTAATGATTCCTAAAAAT
AAAAAAATTGAATTCTTTTTTAGTAATCCGCTGGAGTCTTCTAAAGGTTTGGTAACTTAA
TATCATGAAAGCCACAGGAAAATTATGTCATGCCACTATAAGTATAAATTTGATAATGCC
GAAAAAGAATATTTTTTGTTTGTCTATCATATGAATTCTATCGATGCAGATAACAGTATC
TAATTTGAAGTAAACAATCATTATAAAGTAAAAACTAAGTGTTTTCCTCGTGAGTAGTCA
CTTACTTATCATCTGCCTAAGAGTGATTGGGATATTTCTTAATCTATTTGGAAAGACTTT
AGAGGTGATACTGAAGAGATATTGAGAAAATGCCTCGACAATGATTTATTTTATGCTAGA
ATATTCAAATTTGTTAAAGATGTAGATGATTAAAATTAACTAAGAGAAGCAATAGTTGAA
AAATATTAGATTTGTAGAGATGTTTACAGAAATTTAGCATCTATACAGCCACAGGGTGAT
ACATTTTGTATAGGATTAGGAGTTTTTTAAAGAATGATTTCAAAAACAAAAACACTTGAT
GGAGGAAAAATCAAGCTATCTGATATTGATAGGTTATTTATAGCTACAAATTTTAATTAG
GAAACAAATGAAACTGTTTTAGAAAACAATCCTGCAAAAGCATTAATTAGATATGAATTC
ATAGAAATACTTGTAAGAATAGCCCATGAGAAATATCCATAAATGAAATATGCTGAGGCT
TTTACATATTATTTTGAAAATGACCTTAAAGAGCATTTTATATTGTATTAAATTGCTCAA
GACTGGAGAACAAACAAATATTGGAAAAAAGAAATAGAACATGAGATAAAAAATGAAATT
TAAATGATCAAACCTATTTATGATAGTCTTGTACAGAAAAATCCAGCCTGCTATTAATCT
TCAATAAAATATGTTGACTTGGTAACATTTAGTGATTTCATCGTTAACAAAATATGTCAT
CTGCATCCTCTAAATCAAGCATTAGAAATATAAATAAGAAGTGCATTTTAAATGAGCTTG
TAAACTAGCATAGACGAACTTTCTAGTATGTAATATAAATAAATGGGATTATTAGAATTT
ATTGAAGCCATTGTTAGAATTTCTGAGGTTATTTATAAAAATGAAGACATTCCTCTAAAT
GTAAAAATTCAAAAAATTCTATTCGAAATATACGATGAAGGTGAAAAGCAAGAAATATTA
AAAAGATAAGAATTTGAAAAGATAAAAAGGCTTTAAGAAGAAAAAAAAGAAATTAAAAGA
ATAATACTTAAAACACGCAAAGATTATGAATTTAAATAGTCTGTGTCTCATGGTGCTCTT
TAAAGGTTTTCAAAAGTGAAATTGCTTTCTAATCAAAGTAAATTTTTGCCTTCTGTGTTT
AATAACCATCAAAATGACCACAATGAAATATTTTCAGCACAAAATATTCAATTTTATAAG
AAAAATAGTAAATGA


>TTHERM_00371100(protein)
MGFETGKQLLKGRHHNSASNATEFYASGFHDDQESILMSVLDDSQMDQITAAVYQSYNDS
TMNSSYKHPFMTEIQQNLDTSANLSLKQVLVHSEKKFNLKEERKMQHFTNKLPSINASDD
LQINSMNSFGSQGLIKSSKMSQKYINQMSREDLPSRFSIDPEQYLQNEQEIPLLPNEQRE
WFLPQLKKNGVQLKTEKEIFYQQYKKLSKITQYDKRYKTNKFIYKSMCQKAEECNLLPKT
FEIFKSNSCVHKELNLNNYGIGEQYCKVFSEALQVEDLQHLKKLKISQNNLRGGSLNKIF
KSCASKMKVLDISGNSVRQEDLATFKPLFARTTLAFLNIAQCRIGDTGFTELYQNIKENQ
HLKVLNISMNNLTEISAEKLKKLLTYNTSLQELYLHWNNFKNEGGCEILKGVLENSYLKV
FDISYNSLKYQGDLNEQNQQKAAAYYIAQILSKETSELLHLDVSYNNFSPTECKMIQESL
FYNSWLFGLHFEGNSNYVVDSSGFIVELQNGFRPRMQHKRQIKSIHQIPFFQEDELWDSD
QQQLQDICWICQGWQEVIIQAKDIQEEPLYLHLSYQNFKPELLKKNEEGHYIKSLMIPKN
KKIEFFFSNPLESSKGLVTQYHESHRKIMSCHYKYKFDNAEKEYFLFVYHMNSIDADNSI
QFEVNNHYKVKTKCFPREQSLTYHLPKSDWDISQSIWKDFRGDTEEILRKCLDNDLFYAR
IFKFVKDVDDQNQLREAIVEKYQICRDVYRNLASIQPQGDTFCIGLGVFQRMISKTKTLD
GGKIKLSDIDRLFIATNFNQETNETVLENNPAKALIRYEFIEILVRIAHEKYPQMKYAEA
FTYYFENDLKEHFILYQIAQDWRTNKYWKKEIEHEIKNEIQMIKPIYDSLVQKNPACYQS
SIKYVDLVTFSDFIVNKICHLHPLNQALEIQIRSAFQMSLQTSIDELSSMQYKQMGLLEF
IEAIVRISEVIYKNEDIPLNVKIQKILFEIYDEGEKQEILKRQEFEKIKRLQEEKKEIKR
IILKTRKDYEFKQSVSHGALQRFSKVKLLSNQSKFLPSVFNNHQNDHNEIFSAQNIQFYK
KNSK


>TTHERM_00371100(gene)
ATGGGTTTTGAAACTGGCAAATAACTATTAAAAGGAAGACATCACAATAGTGCTAGCAAC
GCAACAGAATTTTATGCATCAGGTTTTCACGATGATTAAGAATCCATATTAATGTCTGTA
TTAGATGATTCTTAAATGGATCAAATCACGGCTGCAGTATACTAAAGTTACAATGAGTAA
AATCATTTTGAATTCCAAAATTTAGAATAATGTTCGATAGCAAATCTTTTAAAATTATAT
TTATCACTAATAGCTCCACGATGAACAGCAGCTATAAGCATCCATTTATGACAGAAATAT
AATAAAACCTTGATACTTCAGCTAATCTTAGTCTAAAATAAGTACTTGTTCATAGCGAAA
AAAAGTTTAATTTGAAGGAAGAGAGAAAGATGTAGCATTTTACTAATAAGTTACCCAGTA
TAAATGCCTCTGATGATTTATAAATAAACTCGATGAATTCTTTTGGCTCATAAGGTTTGA
TAAAAAGTGTAAAAAGTTCTTCTTATTTTTGTTTATTTCTACTTCTAGTTTATATTAAGT
AGTGTTTGTTACGAGCGAGATCAATTAATAGTTCACACATATAAAAAGAATACATCTATA
ATTGACTTCTAAAAATGTTAAAAATTTAATTATTTAGAGTAAAATGTCGCAAAAGTACAT
AAATTAGATGAGCAGAGAAGATTTGCCCTCTCGTTTTTCTATTGATCCAGAGTAATATCT
ATAAAACGAATAAGAAATCCCTCTCCTTCCAAATGAATAAAGAGAATGGTTTTTACCACA
GTTAAAAAAAAATGGAGTTTAACTGAAGACAGAAAAAGAAATATTTTACTAATAGTATAA
AAAGTTGAGTAAAATTACATAGTATGACAAGAGATATAAAACAAATAAGTTCATTTATAA
ATCGATGTGCCAAAAAGTAAATTATTAATTTTGAATTATGCAAAAGTAGAATTTAGTTCA
ATATTGATACAAATTAACCTCATATTTTATTCTTAATTAATAATAAGCATTAATAAAACA
AGTTTTAATTAATTTTGTTAATAAATTGATTCTCTTTTTGAGTTAAATTTAATAAATCTC
AATATAATTATTAATTCTTTCTAACTAACTAACTAATTAATTATTTAATTGGATGAATAT
TTTTTATAATAATATCAAATTAAAATATTTTTCATCTCAAATTAGGCAGAAGAGTGTAAT
TTACTACCTAAGACTTTTGAAATTTTCAAATCAAATTCTTGTGTTCATAAAGAGCTAAAT
CTAAATAACTATGGCATAGGAGAATAATATTGTAAAGTTTTTTCTGAGGCTCTTTAGGTT
GAAGACTTGCAACATTTAAAAAAATTAAAAATATCATAAAACAATTTAAGAGGTGGGTCG
CTTAATAAAATATTTAAATCTTGCGCTTCCAAAATGAAAGTGTTAGATATTTCAGGTAAT
TCGGTTCGATAAGAAGATTTGGCTACTTTTAAACCTCTGTTTGCAAGAACAACGTAAAAA
ATAACTAATTTTATTAGTTTATATTTTTTTATTTTATAATTTAGACTAGCTTTTTTAAAT
ATTGCTTAATGCAGAATTGGTGATACTGGCTTTACAGAATTATACTAAAACATCAAAGAA
AATTAGCACTTAAAAGTTTTAAATATAAGCATGAATAATTTGACAGAGATAAGTGCTGAA
AAATTAAAAAAGCTTTTGACTTACAATACTAGCTTATAAGAGTTGTATTTGCACTGGAAT
AATTTCAAAAATGAAGGAGGATGTGAAATTTTAAAAGGAGTTTTAGAAAATTCTTATTTG
AAGGTGTTTGATATATCATATAACTCTCTGAAATACTAAGGCGATTTAAACGAATAAAAT
CAGCAAAAAGCAGCTGCTTATTATATTGCTCAAATACTTTCTAAAGAAACTTCAGAGTTA
CTTCATTTAGATGTGTCTTATAATAATTTTTCTCCAACAGAATGGTAAATAAATAAATAT
TTTAAAATAAATAAGTATATTTGTGATTTATTCAAATTTAATAGTAAAATGATTTAAGAA
AGCCTATTCTACAATAGTTGGCTTTTTGGACTTCATTTTGAAGGAAATTCAAATTATGTT
GTTGACTCAAGTGGGTAAAAATAAACTTTAATTTAATTTATGAAGAAATAAATATTTCCT
TTCTTTTTATAACAAATAGCTTTATTGTTGAACTTTAAAATGGTTTTCGCCCAAGAATGC
AGCACAAACGATAGATTAAATCAATTCATTAAATTCCGTTTTTTTAAGAAGACGAGTTAT
GGGATTCAGATTAATAGTAATTATAAGACATTTGTTGGATATGTTAAGGATGGCAAGAAG
TGATCATTTAAGCAAAGGATATCTAGGAAGAACCACTCTACTTGCACTTAAGTTATTAAA
ACTTTAAACCTGAGCTACTCAAAAAGAATGAAGAAGGAGTAAGAATTTTATTGAAGTAGC
TTTATAAATATTTACTTTTTATCAAAATAAATAAAAAGCACTACATAAAATCTTTAATGA
TTCCTAAAAATAAAAAAATTGAATTCTTTTTTAGTAATCCGCTGGAGTCTTCTAAAGGTT
TGGTAACTTAATATCATGAAAGCCACAGGAAAATTATGTCATGCCACTATAAGTATAAAT
TTGATAATGCCGAAAAAGAATATTTTTTGTTTGTCTATCATATGAATTCTATCGATGCAG
ATAACAGTATCTAATTTGAAGTAAACAATCATTATAAAGTAAAAACTAAGTGTTTTCCTC
GTGAGTAGTCACTTACTTATCATCTGCCTAAGAGTGATTGGGATATTTCTTAATCTATTT
GGAAAGACTTTAGAGGTGATACTGAAGAGATATTGAGAAAATGCCTCGACAATGATTTAT
TTTATGCTAGAATATTCAAATTTGTTAAAGATGTAGATGATTAAAATTAACTAAGAGAAG
CAATAGTTGAAAAATATTAGTAAATTGTTTGCAAAATATAGTTTTTAAATTAATTTAAAT
GTCTGATTAATTAGGATTTGTAGAGATGTTTACAGAAATTTAGCATCTATACAGCCACAG
GGTGATACATTTTGTATAGGATTAGGAGTTTTTTAAAGAATGATTTCAAAAACAAAAACA
CTTGATGGAGGAAAAATCAAGCTATCTGATATTGATAGGTTATTTATAGCTACAAATTTT
AATTAGGAAACAAATGAAACTGTTTTAGAAAACAATCCTGCAAAAGCATTAATTAGATAT
GAATTCATAGAAATACTTGTAAGAATAGCCCATGAGAAATATCCATAAATGAAATATGCT
GAGGCTTTTACATATTATTTTGAAAATGACCTTAAAGAGCATTTTATATTGTATTAAATT
GCTCAAGACTGGAGAACAAACAAGTAAATATTTTTTTTTTAACTTCTAAGCTTAAACTTA
ATTTTTAAAAAATATGAAGATATTGGAAAAAAGAAATAGAACATGAGATAAAAAATGAAA
TTTAAATGATCAAACCTATTTATGATAGTCTTGTACAGAAAAATCCAGCCTGCTATTAAT
CTTCAATAAAATATGTTGACTTGGTAACATTTAGTGATTTCATCGTTAACAAAATATGTC
ATCTGCATCCTCTAAATCAAGCATTAGAAATATAAATAAGAAGTGCATTTTAAATGAGCT
TGTAAACTAGCATAGACGAACTTTCTAGTATGTAATATAAATAAATGGGATTATTAGAAT
TTATTGAAGCCATTGTTAGAATTTCTGAGGTTATTTATAAAAATGAAGACATTCCTCTAA
ATGTAAAAATTCAAAAAATTCTATTCGAAATATACGATGAAGGTGAAAAGCAAGAAATAT
TAAAAAGATAAGAATTTGAAAAGATAAAAAGGCTTTAAGAAGAAAAAAAAGAAATTAAAA
GAATAATACTTAAAACACGCAAAGATTATGAATTTAAATAGTCTGTGTCTCATGGTGCTC
TTTAAAGGTTTTCAAAAGTGAAATTGCTTTCTAATCAAAGTAAATTTTTGCCTTCTGTGT
TTAATAACCATCAAAATGACCACAATGAAATATTTTCAGCACAAAATATTCAATTTTATA
AGAAAAATAGTAAATGA