Identifiers and Description

Gene Model Identifier

TTHERM_00959810

Standard Name

LRK3 (Fusion of ser/thr kinase and LRR-containing protein.)

Aliases

PreTt23667 | 178.m00048

Description

Fusion of ser/thr kinase and LRR-containing protein. Protein kinase domain containing protein. Sequence similarity to a protein kinase family unique to Tetrahymena thermophila (Eisen et al., 2006)."

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11%

TetraMine Data

TTHERM_00959810

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08014.16.999281070199524e-80hypothetical protein (2073 aa)
DictyBaseDDB_G02904851.999790113608142e-24dlrA on chromosome: 5 position
4410371 to 4413091
WormBaseWBGene000083111.0004572433669413e-23locus:rskn-2 Putative riboso
mal protein S6 kinase alpha-2
status:Partially_confirmed
UniProt:Q18846 protein_id:C
AA99814.2
SGDYFR014C1.9999391735788327e-19CMK1 Calmodulin-dependent prot
ein kinase; may play a role in
stress response, many CA++/ca
lmodulan dependent phosphoryla
tion substrates demonstrated i
n vitro, amino acid sequence s
imilar to Cmk2p and mammalian
Cam Kinase II
OxytrichaContig10460.0.g1032.000769134519826e-18Protein kinase domain
Stentor CoeruleusSteCoe_73690.0000000007582560427911907

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00959810(coding)
ATGTCTAAGAAATTAAAATTCGAATTAGTTTAAGCTATCTCAAGCAAAATATCTAAAGAT
TGCTAAATTCAAAAAGCATCATTAAAGGAATTGGTTAATTTGATGTTCAGCTAGAAAAAA
TACTTCAAAAATTTTGAGTATATTAGCAATGGCTCATTTGCTCTTATCTTAAAAGCTTAT
AACTCTAAAGAAAATCGTCAAGTAGCTCTCAAATTCTTAGTATGCTGTAGCGAAGGGTAC
TAGGATTAAATGGAATCTTTGAAAAAAGAATATGAAATCCTTCAAAAATTTGGATAATCA
TAATTTTTAGTCGATGTCTACGATTGTTTCTATTTAATGGAAGAAGAAGAAGATGAGGAT
GAAGATGGAAACGAAATAATCGTTTAAAATGAATACAAATCATTCTTTGTTTTGGAAATG
GAATGTTGTGAGCACAATCTTAAAGGGCTCTTCGATTATTTCAGAAAATAATAAGTACCA
CCTTCGAAAGAGATCAAGGAAATAATAGCCATCCAAATGTTAGAGGGGCTGAATAACATT
CACGTCAAAAACATTATCCACAGGGATATCAAGCTTTCAAACATCCTTGTTCGTCCTTCT
CAGGAATATGGTTTCTAAATAAAAATTTCTGATCTAGGTTTTGCAACACATGTGTCTAAA
TCAAAAAGCTTCTGTTCAAGGAAAGGAAGTGATGAATATCTTGCTCCAGAAGCGGAAAAA
GGACAATATAGAATTCAATCAGATCTCTTTTCACTAGGTCTTATTTTATTAGAGCTAGAC
AATGTTATGACTCTAAATGAGGATTGGATAGATTTCGAAACTAAACTGAATCTATTCAAT
GGAAAAGAAATACCTGATGAAAAATATTAGATAGATAAGAATTCTAATATATACAAAATA
GCTTAAATATGCTTAAAGCCTTCATATTTAGAAAGGACTACAGCAGGAGATTTACTATCC
TAACTAATCGAAATGCATGGTTAACCATTAAAATTTGTGTTGACTTCTATGATACTAGAG
GAATCAATACCTATATAGGCACAATAAATAATTAATAAACTGTTGTAAAATGAAAAGCAT
TAATCTTTTGATCAGTATGCTTAGTTTATTCTAGACAACACAAATGAGAAAATTATAAAA
CAAGATGTTCAAGCACAATTTACAAATGTAGAAGTATTATCTAATCTGCTGAAAAGTCTC
TTTGAAAATAAAAAATATTCGAATTACTATTAAATTCTTAGCTTTGGAAGTTAGGGAATG
ATTTTAGCTACTAAAAAAGTTAATCTTGATAACAAAGAAATAGTACTAAAAATACAAAAA
ATAATAGATGAATAAAAAATCTAAAATGAAATTAGTATTATGTAGAAATTAAAAGAGCCT
CTAGTGGTATAGCTTTATGATAGCTATATAATAGAAAATATAGTAGGATCTGATAGATAC
TCAGTCTTAGAATTAGAAAAATGTTCATGTACATTAGATGAATATCTCGACAGAAAAAAC
AAAGATGGATAATTTAGCGAAGATGATAAATTTTAAATAGCCATCAAAATTATAGATTCT
GTCAATTATATTCACTCATTAAATTTCATTCATAGAGATATCAAACCATAAAATTTTTTG
GTTTGTTTAAATGAAAATGAAGTCGAAATAAAATTATGTGATTTCGGTGTGTCTGCTTAG
ATTCCAGATAATAGAAATTCAATTCAAACTAAAGAGTTCGTTGGAAATTTAGGATATTCA
GCACCTGAAATTTTAAATAAAAAGGATAATGAACTTAAGTTTTATACAAAGAAATCTGAT
TCATATTCAGTAGGGCTATTGTTAACTTTGATTGACAATTACTACATTCTAAATAAAAAT
GCAAGTTTAACTTTTGCATTAATGACACAAAAGCAGCTAGATAAGCCTTTCGAAAAATCT
AATATTAAAATTAACAAAAATTCAAAAATTTATAAACTTATTAAACTTCTTGTAGTTTCT
GATTGTGATAAGAGAGTATCTCTTTATGATATTGTTGAAAAAAGTGGTTACTAATTCTTT
TCAAATTCAAAAAAAATGAAATAAATTCTACAAAAAACTCCTGTGATGCAAAATGATGAA
AAAGTAGAGCAAAATAAGTCTATTGAAATTAATTCTATCGAAGATTTGAATAAAATTTAA
AATTACAATATTGTTACAATAAATTTAAGTAAAAATATTATTGGTGCACATCCTGTAAAA
GATTTAGGCAATAGAATAGCCTAGTTCAAGAATATTATAAGTTTGACACTTGATTTAAGA
AGTAGTAGTATTGGCGATGAGGGTGCAAAAAATATAAGAACAGGAATAGAGTAGTGCAAG
AATCTCACAAGTTTGACACTTGATTTAAGAAATAATAGTATTGGTGATGAGGGTGCAAAA
AATTTAGCAATGGCAATAGTGTTGTGCAAGAATATCACAAATTTAAATCTTAATTTAAGT
ACAAATTAAATTGGTGATGAGGGTGCAAAAGATTTAGGCTAAGGAATAGTATTGTTCAAG
AATATCACAAATTTAAATCTTAATTTAAGTACAAATTAAATTGGTGATGAGGGTGCAAAA
GATTTAGGCAAAGGAATAGCATACTGCAAGTATATCACAAATTTGAAACTTGATTTAAGT
GCAAATGGTATTGGAGAATATGGTGTAAAAGATTTAGGTACAGGAATAGCGTAGTGTAAA
AATATTACAAGTTTGACACTTAAATTAGTTGAGAATAGCATTGATGAATATGGTGCAAAA
GATTTAGGCATGGGAATAGCTTAATGCAAGAATATCACAAGTTTGATACTTGATTTAAGT
ACAAATAGTATTGGTGAATATGGTGCAAAATATTTAGGCATAGGAATAGCTTAATGCAAG
AATATCACAAGTTTGGCAATTAATTTAAGTAAAAATAGTATTGGTGAATATGGTGCAAAA
GATTTAGGCACAGGAATAGCTTAATGCAAAAATATCACAAGTTTGACACTTGATTTAAGT
GAAAATAGCATTGGTGCATAGGGTGTAAAAGATTTAGGCACAGGAATAGCTTAATGCAAG
AATATTACAAGTTTGACACTTTATTTAAGTAAAAATAGTATTGGAGCATAAGGTGCAAAA
GATTTAGCCACAGCAATAGCTTAGTGCAAAAATATTGCAAGTTTGACACTTGATTTAATA
GAAAATAGCATTGGTGCATAGGGTGCAAAAGATTTAGGTACAGGAATAACGTAATGCAAG
AATATTACAAGTTTAACACTTGATTTAAGGGAAAATAGTATTGATGCATATTACGCAAAA
GATTTAGGTACATAAATAGCGTAGTACAAGAATATCAAAATCTGA


>TTHERM_00959810(protein)
MSKKLKFELVQAISSKISKDCQIQKASLKELVNLMFSQKKYFKNFEYISNGSFALILKAY
NSKENRQVALKFLVCCSEGYQDQMESLKKEYEILQKFGQSQFLVDVYDCFYLMEEEEDED
EDGNEIIVQNEYKSFFVLEMECCEHNLKGLFDYFRKQQVPPSKEIKEIIAIQMLEGLNNI
HVKNIIHRDIKLSNILVRPSQEYGFQIKISDLGFATHVSKSKSFCSRKGSDEYLAPEAEK
GQYRIQSDLFSLGLILLELDNVMTLNEDWIDFETKLNLFNGKEIPDEKYQIDKNSNIYKI
AQICLKPSYLERTTAGDLLSQLIEMHGQPLKFVLTSMILEESIPIQAQQIINKLLQNEKH
QSFDQYAQFILDNTNEKIIKQDVQAQFTNVEVLSNLLKSLFENKKYSNYYQILSFGSQGM
ILATKKVNLDNKEIVLKIQKIIDEQKIQNEISIMQKLKEPLVVQLYDSYIIENIVGSDRY
SVLELEKCSCTLDEYLDRKNKDGQFSEDDKFQIAIKIIDSVNYIHSLNFIHRDIKPQNFL
VCLNENEVEIKLCDFGVSAQIPDNRNSIQTKEFVGNLGYSAPEILNKKDNELKFYTKKSD
SYSVGLLLTLIDNYYILNKNASLTFALMTQKQLDKPFEKSNIKINKNSKIYKLIKLLVVS
DCDKRVSLYDIVEKSGYQFFSNSKKMKQILQKTPVMQNDEKVEQNKSIEINSIEDLNKIQ
NYNIVTINLSKNIIGAHPVKDLGNRIAQFKNIISLTLDLRSSSIGDEGAKNIRTGIEQCK
NLTSLTLDLRNNSIGDEGAKNLAMAIVLCKNITNLNLNLSTNQIGDEGAKDLGQGIVLFK
NITNLNLNLSTNQIGDEGAKDLGKGIAYCKYITNLKLDLSANGIGEYGVKDLGTGIAQCK
NITSLTLKLVENSIDEYGAKDLGMGIAQCKNITSLILDLSTNSIGEYGAKYLGIGIAQCK
NITSLAINLSKNSIGEYGAKDLGTGIAQCKNITSLTLDLSENSIGAQGVKDLGTGIAQCK
NITSLTLYLSKNSIGAQGAKDLATAIAQCKNIASLTLDLIENSIGAQGAKDLGTGITQCK
NITSLTLDLRENSIDAYYAKDLGTQIAQYKNIKI


>TTHERM_00959810(gene)
ATGTCTAAGAAATTAAAATTCGAATTAGTTTAAGCTATCTCAAGCAAAATATCTAAAGAT
TGCTAAATTCAAAAAGCATCATTAAAGGAATTGGTTAATTTGATGTTCAGCTAGAAAAAA
TACTTCAAAAATTTTGAGTATATTAGCAATGGCTCATTTGCTCTTATCTTAAAAGCTTAT
AACTCTAAAGAAAATCGTCAAGTAGCTCTCAAATTCTTAGTATGCTGTAGCGAAGGGTAC
TAGGATTAAATGGAATCTTTGAAAAAAGAATATGAAATCCTTCAAAAATTTGGATAATCA
TAATTTTTAGTCGATGTCTACGATTGTTTCTATTTAATGGAAGAAGAAGAAGATGAGGAT
GAAGATGGAAACGAAATAATCGTTTAAAATGAATACAAATCATTCTTTGTTTTGGAAATG
GAATGTTGTGAGCGTAAAAATAAAATAATATATTTTTCATCCATTTTTTTTCTTCATTTT
TTAAAAAGGCCTGAAAATACAAAACAAAATATATTCATATTTTTTATTGACTTGAAATTT
GACATGAATTTAATTAAGATATCCATTGTAATTTCATTTATTTTTCTGAATTTTTTCAGA
TTTTGATAACTCAAGAGAAAAACATTAGATTTTCGCTAAACAAATTTAATTAATTTAGAA
AAAATAGTTGAAATTATTTGATATATAAAAATTAATTCATTTTTTAGAATTCCTCTCAAC
TAAGACTTTTTTCATTTATTTTTATCAAATTTTGTATAATTTCTTAATTAAAGCTTCATA
ATATATATCTTATAACATATTTATTTCCCTAATATTTCAATATAAAATTTTATTAAAGAA
TTTAAAAAAATATTCAGTTAAATTTCTTTAATAAGACTTAAATATTAAATCACTCTAATT
TAATAAATTTATATTAAATTTGAAAAAAATTTAAATTAATTTTAAACTTAATTAAATATG
TTAAATTAAATATTTTTTATATTATCATTTGAAAATGAATCTAACAAATTTATAAAATAG
CTAAATGATAGTTTTTTACTTTTATAAATTAGGTATAAACAAACAAACAATAATATTCAT
ATTAAATTTAATAAAATTGAATTATTTAAATACTAAATAAATGAAGAAATCAAATTTCTA
AGATTCAAGAAAATTAAAACTAAATTTTTTCTATCTAGTTTTAAAAATTAAATTATTAAT
TAAATGCTAAAATGAATAATTAATTTACCAACTTATAAATGAAAATTTTTAATTTTAATT
TTAATATAAAAACCATAATTAATTAAATTTTATAATTAACTAGACAATCTTAAAGGGCTC
TTCGATTATTTCAGAAAATAATAAGTACCACCTTCGAAAGAGATCAAGGAAATAATAGCC
ATCCAAATGTTAGAGGGGCTGAATAACATTCACGTCAAAAACATTATCCACAGGGATATC
AAGCTTTCAAACATCCTTGTTCGTCCTTCTCAGGAATATGGTTTCTAAATAAAAATTTGT
ATAAATTTATTTAATAATTTATTAATTTTCTTTTCTTAATAAATATTTTTAAAATTTAGC
TGATCTAGGTTTTGCAACACATGTGTCTAAATCAAAAAGCTTCTGTTCAAGGGTTAAAAA
ATTAAATTATTTTTTAATATTTTAAATATTTTTTATAATTTTCAGAAAGGAAGTGATGAA
TATCTTGCTCCAGAAGCGGAAAAAGGACAATATAGAATTCAAGTTTTTATTTAAAAGTTA
TAAATTAATTTTTAAAATTTTAATTAAATTAAATAGTCAGATCTCTTTTCACTAGGTCTT
ATTTTATTAGAGCTAGACAATGTTATGACTCTAAATGAGGATTGGATAGATTTCGAAACT
AAACTGAATCTATTCAATGGAAAAGAAATACCTGATGAAAAATATTAGATAGATAAGAAT
TCTAATATATACAAAATAGCTTAAATATGCTTAAAGCCTTCATATTTAGAAAGGACTACA
GCAGGAGATTTACTATCCTAACTAATCGAAATGCATGGTTAACCATTAAAATTTGTGTTG
ACTTCTATGATACTAGAGGTAAAATATTAATTATCAAATAATTGTTTTAAAAATAATATC
TAAATTAAAATAATGCAAAAAAAAATAATTATTTTTTCAATCTTTCCCAAACAATTTAAT
TTTACTATAACTCTTAATAAAACAAAATATTTTATATATACTTTCCTAAAAAATGAGATC
AAATAAAAATAATATTTATTTATTTATTAAAAAAAATAAGAGGTGGGCATGAATAATATT
TGAATAACAATAAATGAATATGAATAAATTTTTATAAAGCTATTCATAAAATTTTTAAAT
TTTACAATCAATATTCATGCCCACCTCTGTCTGTTTGTTATATATTAAAATAAGAATAAT
TAGTCTATTTTTTATTAATTATATTTTAAATTTAAAATGGCAAAATAAAATATGTTAATT
AATTTTATTAGAATTGATTGAAATTGCTGTTTTTCTTCACTAATTAATATAAAATTAAAT
TTAATACAAAATTCAATTTATTTTTATTACTCTTAAGATAAAAGATTAAATTTTTTATTA
TATTATGTTTGAAATCAATAAATATTTTCATAATAAAAGGAATCAATACCTATATAGGCA
CAATAAATAATTAATAAACTGTTGTAAAATGAAAAGGTAAAAATTATTTATTTTTAGTAA
AAATTTTTACAAAAAATTAGAATTAAATGCAAATTTATGATTATTAATTTTAAAGCATTA
ATCTTTTGATCAGTATGCTTAGTTTATTCTAGACAACACAAATGAGAAAATTATAAAACA
AGATGTTCAAGCACAATTTACAAATGTAGAAGTATTATCTAATCTGCTGAAAAGTCTCTT
TGAAAATAAAAAATATTCGAATTACTATTAAATTCTTAGCTTTGGAAGTTAGGGAATGAT
TTTAGCTACTAAAAAAGTTAATCTTGATAACAAAGAAATAGTACTAAAAATACAAAAAAT
AATAGATGAATAAAAAATCTAAAATGAAATTAGTATTATGTAGAAATTAAAAGAGCCTCT
AGTGGTATAGCTTTATGATAGCTATATAATAGAAAATATAGTAGGATCTGATAGATACTC
AGTCTTAGAATTAGAAAAATGTTCATGTAATTTATAAAACTATTATTAACATTTATTTTA
ATTTAAGTTTTATTAAATAATTAAAGTGATATTTTTGTATTATAAAAATACATATTAAAA
TTTAATTAGATTTAAAAAATTTTTTAAAATGAAATTATTTTCGTTGCTATTTAAGCATTT
AATTTATTTAGAAACACTTTTATATAAAAATTATTGTTTCTTGTTATGTTTGATTAAATT
TTAATATTTATTTTTTAAAAGGTACATTAGATGAATATCTCGACAGAAAAAACAAAGATG
GATAATTTAGCGAAGATGATAAATTTTAAATAGCCATCAAAATTATAGATTCTGTCAATT
ATATTCACTCATTAAATTTCATTCATAGAGATATCAAACCATAAAATTTTTTGGTTTGTT
TAAATGAAAATGAAGTCGAAATAAAATTATGTAAACTCTTTTTATTCATTAATTATTTTT
CATTACCTTTTGATTTAAAGGTGATTTCGGTGTGTCTGCTTAGATTCCAGATAATAGAAA
TTCAATTCAAACTAAAGAGGTAGATTTTTTAATTCTAAATATTTATTTTAAATATTAAAA
TAAATTTATAGTTCGTTGGAAATTTAGGATATTCAGCACCTGAAATTTTAAATAAAAAGG
ATAATGAACTTAAGTTTTATACAAAGAAAGTAAGTACTTTCTTTATAAAAAAAAATATTA
ACTTTAAAATTTTTTTAAATTTTAGTCTGATTCATATTCAGTAGGGCTATTGTTAACTTT
GATTGACAATTACTACATTCTAAATAAAAATGCAAGTTTAACTTTTGCATTAATGACACA
AAAGCAGCTAGATAAGCCTTTCGAAAAATCTAATATTAAAATTAACAAAAATTCAAAAAT
TTATAAACTTATTAAACTTCTTGTAGTTTCTGATTGTGATAAGAGAGTATCTCTTTATGA
TATTGTTGAAAAAAGTGGTTACTAATTCTTTTCAAATTCAAAAAAAATGAAATAAATTCT
ACAAAAAACTCCTGTGATGCAAAATGATGAAAAAGTAGAGCAAAATAAGTCTATTGAAAT
TAATTCTATCGAAGATTTGAATAAAATTTAAAATTACAATATTGTTACAATAAATTTAAG
GTAATTTTTTCATTTAAACATATGCTTTTAACGTTTTATTAACTGTCAATTTTACACATT
TTTTAATTATTTTATTTGATAATAGTTTTCCCTTAATTATTAACTTATTAAAGTAAGTTA
ATTATTTAAATTAAGTAAAAATTCAATATTCAGGAGAAAAAATATAATTTTTTGCCATAA
AAAAAAATTCCTCTTCTGAATTAGAGATTTTCCAGTAATTTTTAATTTTTCTGCAAAATT
TATAAATAAATATTTTGATGACATTTTTACTATTTTTCATTTAATGCATCAAAATATATC
AGAAAATCAAATTTAAAAATATACATAATCTTTAATTAAATTATGTATATTTCTAAAAAT
TTATTAAATCATCACTAATAAATAGCATAAATAGCGATGACTATTTTTTAAAATAGTAAA
GTGCTATATTAATCACTATCATAAATATATATTATATCACTCAATATACTTATAATTATT
ATTTGAAAGGCTTTAAATTGTTATTTGATAGATAATGTAGCAGGTGTTTTAATATAAAAA
ATTGGTACACAATTTTTGGCCACCCGTTACTAAATTACTACTCAACTAAAAAACAATCTA
TTTACTTAGTTACTTCTTCAAAAAAATTAAATGACTAAAAAAAGCACCAATCTTTTTTTA
CAACCCTTTTTCCTCCAAATTTATTTTCTAAATTAATTATTTATTCTTATATTTAAAGTA
AAAATATTATTGGTGCACATCCTGTAAAAGATTTAGGCAATAGAATAGCCTAGTTCAAGA
ATATTATAAGTTTGACACTTGATTTAAGGTAAAAAAATAATTTATTAATTAATAAAACAA
GAAATATTGATAAAATTGATTATTTTATTGATTTTTCACTTAGCAAATTAACTTTTTGTT
TGTTATTTATATTTATTTTTAATATATTGTAATTTTTTACTTGCTTCTTTAAAAGCAAAC
TAAAATATAGAAATAAAAGCATCAATTTTTTTTTACAATCCTTTCACCTTCAAATTTATT
TTCTTAATTAATTATTTAAAAGAAGTAGTAGTATTGGCGATGAGGGTGCAAAAAATATAA
GAACAGGAATAGAGTAGTGCAAGAATCTCACAAGTTTGACACTTGATTTAAGGTAAAAAT
TTAATTTATTGATTGATTAATAAAGCAAGAAATATGATTAAAATTTATTATTTTGCTGAT
TTAATCTTTTCACTTAGTGATTAGCAAATTAACTCTATTCAATCAATAAATTTGTTTACT
TACTTCTTTAAAAATAAAATACTAACAAATAGAGCAAATTTTTTACAATCATTTCTACTC
CAAATTTATTTTCTTAATTAATTATTTAAAAGAAATAATAGTATTGGTGATGAGGGTGCA
AAAAATTTAGCAATGGCAATAGTGTTGTGCAAGAATATCACAAATTTAAATCTTAATTTA
AGGTAAAACATTAATTTTTTGATTGATTAATAAAGCAAGAAATAAGATTAAAATTGATTA
TTCTGATGATTTAATCATTTACTTAGCGATTAGCAAATTAAATCTACTAATAAATAATCA
ATTTGCTTACTTACTCTTTTAAAAATAAAATTAAATACTAACAAATGGAGCAAATTTTTT
TACAATCCTTTCTACTCCAAATTTATTTTGTTAATTCTTTACTTTTTTTATATTTAAAGT
ACAAATAGTACACTCAAAAAAAATAAAAAAAATATTTTTAAAATTATTTTTACAATCCTT
TCTACTCCAAATTTATTTTGTTAAAACATTATTTATTTTATATTTAAAGTAAAAATGGTA
TTAGTAATGAAGGTGCAAAAGTTTTAGGCATCGGAATTTTTTGCACCTTTATCACTAATA
CTGTTTCCCCTTTTAAATAATGAATGAAGAAAATAAATTTGGAGGTGAAAGGATTGTAAA
AAAATTGATGCTTTTATTTGTATTTTAGTTTAATTTTAAAGAAGCAAGTAAACAAGTTAC
AATATTTTAAAAATAAATATAAATAACATCAAACTGTTAATTTTCACTAATTGAAAGGTC
TATGTCATATAATAATCAATTTCATTTATATGTCTTGTTTATTAATTAATTTATTGATTG
ATTAATAAAGCAAAAAATATTAATAAAATTGATTGTTTTGCTGATTTAATCTTTTCACTT
AGTGATTAGCAAATTAACTCTACTAATAAATAATCAACTTTTTTACTTAATCCTTTAAAA
ATAAAATAAAATACTAAGAAAAGCAGCAATTTTTTTTACAAACTATCCTTTCTATACCAA
ATTTATTTTATTAATTCTTTATTTATTTTATATTTAAAGTACAAATTAAATTGGTGATGA
GGGTGCAAAAGATTTAGGCTAAGGAATAGTATTGTTCAAGAATATCACAAATTTAAATCT
TAATTTAAGGTAAAAAATTAATTAATTAATTTATTGATTGATTGATTAATAAAGCAAGAA
ATATTAATAAAATTGATTGTTTTGCTGATTTAATCTTTTCACTTAGTGATTAGCAAATTA
ACTCTACTAATAAATAATCAACTTTTTTACTTAATCCTTTAAAAATAAAATAAAATACTA
AGAAAAGCAGCAATTTTTTTTTACAAACTATCCTTTCTACACTAAATTTATTTTATTGAT
TCTTTATTTATTTTATATTTAAAGTACAAATTAAATTGGTGATGAGGGTGCAAAAGATTT
AGGCAAAGGAATAGCATACTGCAAGTATATCACAAATTTGAAACTTGATTTAAGGTAAAA
AAAAATAATTTATTAATTAATAAGCAAGAAATATAGATAAAATTGGTTATTTTATTGATA
AAAATATAGATAAAATTGATTATTTTATTGAAGTTTTTCATTTAATAATAGGCAAATTAA
ATTAGTTTGTTATTTTTTTATATTTTATTCTATTCTTTATTTACATACATATTTACTTAG
AATTCAACAAAATATAATCAATTTCGTTTCTTACTCCTTCAAAAATAAACTAAAATACGA
ATAAGATCAGCAATCTTTTTTACAATCCATTCCCTCCAAATTTATTTTCTTAATTTATTA
TTTAAAAGAGGAAATAGTATTGGTAATTAGGGTACAGAATATTTAGCGTATTAAATGAAT
ATCACATATTTGATACTTGAATTAAGATAAAAATTTAATTTGTTGATTGATTGAGAAAGC
AAGAAAAATAAATAAAATTGATTAATTTGCTGATTAAATTTTTTCACTTAGTAATAAGTA
GGGTTAGACCGAATATAAATTTTTAAAACAATACCAAATAAACAATTTTTTAATACCAAA
TAATAATTTTATTTAATAAAACCGAATATTCGATCTGACCCTAGTGATTAGCAAATTTAA
TCTATTTGTTTGTTATTTAATTATTTATTTATTTAATTTTTATTAGATTATTTATTTACT
TTCATATTTACTTACAACTCTACTAATAAAATATCAGTTTTTTTACAATCCTTTCTGTTC
CAAATTTATTTTATTAATTCATTATTTATTTTATATTTAAAGTGCAAATGGTATTGGAGA
ATATGGTGTAAAAGATTTAGGTACAGGAATAGCTTAATGCAAGAATATCACAAGTTTGAC
ACTTGATTTAAGGTAACAATTTAAATTATTGATTTATTGATAAAGCAAGAAATATAAATA
AAACTTATTATTTTGCTGATGTAATCTTTTCACTTAGTGATTAGCAAATTAAATCAATTT
ATATTTTATTTAATTATTTATTTATTTATTAGATTGTTTATTTACAAACATACATACTTA
CTTACTTATAACTCAACTAAAAAATAATCAATTTATTTCTTACTCCTTCAAAAATAAACC
AAAATATAAACGAAAGCATCAATCTTATTTTACAATCCTTTCAGTTCCAAATTTATTATA
TTAATTCATTATTTATTTTATATTTAAAGTGCAAATAGTATTGGAGCATATGGTGCAAAA
GATTTAGGTACAGAAATAGCTTAATGCAAGAATATCACAAGTTTGACACTTGGTTTAAGG
TAACAACTTAATTTATTGATTAATAAAGCATATTGATAAAATTTATTATTTAGTTGATTT
ATGCTTTTTACTTTTTAATTAGTAAGTTAAATTAATTTGTTTGTTATTTATTTATTTTTA
TATTCTAATTTGTTTACTTACTCCTTTAAAAGCAAACTAAAATACAAATAAAAGCAACAA
TATTTTTACAATCCTTTCTCCTCCAAATTTATATTATTAATTAATTTTATATTTAAAGGA
TAAATAATATTGGTGCATAGGGTGCATAAGATTTAGGCACAGGAATAGCTTAATGTAAAA
ATATCACAAGTTTGACACTTGATTTATGGTAAAAGCATCATTTATTGATTGATAAAGCAA
GAGATTTTTTAAAAACTGATTATTTTGTTGATTTAAGCTTTTTACTTAATGATGAGCAAA
TTACATGAGTTTGCTAGTTATTTTTTATCTCTTAGATATATTATTTACATGCATACATAC
ATACTTACTTACTAATCAATTAAATAATCAATTTTTTTGCTTAATCCTTTAAAAACAAAA
CAAAATACTTGCAAAAAAAGCAATATTTTTTTGCAACCTTTTCTACTCCAAATATATTTT
ATTAATTCATTATTTATTTTATATTTAAAGTACAAATAGTATTGGAGCATAGGGTGCAAA
AGATTTAGGTACAGGAATAGCGTAGTGTAAAAATATTACAAGTTTGACACTTAAATTAGT
GTAAAAAATTAATTTATTAATTGATAAGTTTAGAAATTTAGATAAAATTGATTATTTTAC
TGATTTAATCTTTTCACTTAATAATTAGTAAATTAAATCAGTTTGTTTGTTTGTTATTTA
ACTATTTACTTATTTATATATATTTTATTAGATTATTTATTTACATAAATACTTACTTTC
TACTCAACTAAAAAACAATAAATTTATTTATTAAAGTGAGAATAGCATTGATGAATATGG
TGCAAAAGATTTAGGCATGGGAATAGCTTAATGCAAGAATATCACAAGTTTGATACTTGA
TTTAAGGTAACAATTTAATTTCTTAATGAATAAAGCAAGAAATATTATAAAAATTGATTA
TTTTGTTGATTTAAGCTTTTCAATTAACTATTAGCAAATTAAATTAGTTTGTTAGTTATT
TATTTATTCTTTTAGATATCTTATTTACATATATATTTACTTACTAATCCATTAAATAAT
AAATTTGTTTACTTTAAAAACAAAACAAAATACTTACAAAAGAAGCAAATTTTTTTGCAA
TCTTTTCTACTCAAAATTTATTTAAAATTTAAAGTACAAATAGTATTGGTGAATATGGTG
CAAAATATTTAGGCATAGGAATAGCTTAATGCAAGAATATCACAAGTTTGGCAATTAATT
TAAGGTAAAAGCATAATTTATCGATTGATAAAGCAAGAAATATTATAAAAATTGATTATT
TTGTTAATTTAAGCTTTTCACTTAATTATTAGCATATTAAATTAGTTTGTTAGTTATTTA
TTTATTTATTCTCTTATATATCTTATTTATATATATATTTACTTACTAATCCATTAAATT
ATCAATTTGTTTATTTAATACTTTAAAAACAAAACAAAATACTTATAAAAGAAGCAATTT
TTTTTTCAATCTTTTCTACTCAAAATTTATTTAAAATTTAAAGTAAAAATAGTATTGGTG
AATATGGTGCAAAAGATTTAGGCACAGGAATAGCTTAATGCAAAAATATCACAAGTTTGA
CACTTGATTTAAGGTAACAATTTAATTTATTAATTAATAAAACAAAGAGATAAAATTGAT
TATTTAGTTGATTATTGCTTATCAGTTTGTAATTAATTATTTATTAATTTTTGTTATATT
CTAATTTATTTACTAACTCCTTTAAAAGTAAACTAAAATAAAAATAAATACACCAATACT
TTCTCCTCTAAATTAATTTTTTAATTCATTATTTATTTTTATATTTAAAGTGAAAATAGC
ATTGGTGCATAGGGTGTAAAAGATTTAGGCACAGGAATAGCTTAATGCAAGAATATTACA
AGTTTGACACTTTATTTAAGGTAAAAAGATAATTTATTAATTGATAAAGCAAGAAATGTT
ATAAAAATTGATTATTTTATTGATTTAGGCTTTTCACTTAATTATTAGCATATTAAATTA
GTTAGTTATTTTTTTTTATTTTTCTCTTAGATATCTTATTTAAATACATACATACATGCA
TACTTACTTACTAATCAATTTTTTTCTCCTTAATCCTTTAAAACAAAACAAAATACTTAT
AGAGGATGCAATCTTTTTTTGCAACCCTTTCTACTCCAAATATATTTTATTAATTCATTA
TTTATTTTATGTTTTAAGTAAAAATAGTATTGGAGCATAAGGTGCAAAAGATTTAGCCAC
AGCAATAGCTTAGTGCAAAAATATTGCAAGTTTGACACTTGATTTAATGTAAAAAATTAA
TTTATTGATTGATAAGTTAAGAAATATAGATAAAATTGATTATTTTGCTGATTTAATCTT
TTCACTTAGTGATTAGCAAATTAAATCAGTTTGCTTGTTTGTTATTTAACTATTTATTTA
TTTATATATATTTTATTAGTTTATTTATTTATTTACATACATAATTACTTTCTACTCAAC
TAAAAAACAATCAATTTGTTTACTTACTCTTTCAAAAGCAAATTAAAAAACTAATAAAAG
CATCAATCTTTTATTACAATCCTTTCTCCTCCAAATTCATTTCTTCATTCATTATGTATT
ATTATATTTAAAGAGAAAATAGCATTGGTGCATAGGGTGCAAAAGATTTAGGTACAGGAA
TAACGTAATGCAAGAATATTACAAGTTTAACACTTGATTTAAGGTAAAAACTTAATTTAT
TGATTAATAAAGTAAGAAATATATAAATAAAATTGATTATTTTGATGATTAACTCTTTTC
ACATAATTCTTAACAAGTTAAATAATTATGTTCGCTATTTATTTATTTTTTTTAGATTGA
TTATTTGCCTACATATATAATTACTTATTTACTATTCAACTAAAAACTGTCCAATTTGTT
TGCTTACAACTTCAAAAATAAATTAAAACACTAAAAAAATTAGAGATTTTTTTTCTATCT
TTTCTCTTCCATATTTTTATTAATTCATTATTTATTCTTATATTTAAAGGGAAAATAGTA
TTGATGCATATTACGCAAAAGATTTAGGTACATAAATAGCGTAGTACAAGAATATCAAAA
TCTGA