Identifiers and Description

Gene Model Identifier

TTHERM_01155710

Standard Name

LRK1 (Fusion of ser/thr kinase and LRR-containing protein.)

Aliases

PreTt24007 | 257.m00032

Description

Fusion of ser/thr kinase and LRR-containing protein. Protein kinase domain containing protein. Sequence similarity to a protein kinase family unique to Tetrahymena thermophila (Eisen et al., 2006)."

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_01155710

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_40732.11.000371485572848e-69hypothetical protein (643 aa)
SGDYCR073C3.998609120989657e-17SSK22 MAP kinase kinase kinase
of the HOG1 mitogen-activated
signaling pathway; functional
ly redundant with, and homolog
ous to, Ssk2p; interacts with
and is activated by Ssk1p; pho
sphorylates Pbs2p
OxytrichaContig10395.0.g1254.997543945741262e-17Protein kinase domain
DictyBaseDDB_G02904859.001232279470736e-16dlrA on chromosome: 5 position
4410371 to 4413091
WormBaseWBGene000120190.000000000000004001928599951003locus:dkf-2 Serine/threonine
-protein kinase dkf-2 status
:Partially_confirmed UniProt
:O45818 protein_id:CCD31057.
1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01155710(coding)
ATGTCAAGTTCTAAGTAAGTTAGATAAGAAGTTGAGAAACAAATCAAAAATTGTATCATC
AAGAAGCAAAATGTCAAGAAGTTTTTCAAGTTAATGAAAAAATAGTAAAAGCACTATCAG
ATTTTGCAGTTTGCAGGAAATGGAACTTTTGCATTGGTCCTAAAGGCTATCAACAAAAAT
ACAGGCTAAACAGTGGCTCTTAAAGCTGTAGAATGTGATGAAAGCGACTTAAAAGGGATG
GAAGTTATTCAAGACGAGTACAAAATGCTGGAGGTATTCAGCGGTTGTAAGTATATAATC
AAAGTATTCAACAGTTTCTACCTTACTGAAAGCATCGATTCTGATTCTGATGAAGATGAT
GATTAAATTCCAGTAGACCAAAATAACAACTAATCAAGCTTATTGAGGGTATTCTATGTT
ATGGAATAGGAATTCTGTCAAACTACTCTATCGTCATTCATTGATACATGTAGGCAAAAA
AATAGCTATCCAAGCTAATAAATGAAAGAAATAATGACTATCTAAATCTTAGATTCAGTA
GCTTTTTTGCACAGGTTTGATGTTGTGCATAGAGATATAAAGCCATCAAACTTTTTGCTT
AACTTTGACCAAAACGGCAATCCAACTCTTAAGCTATGTGATCTGGCTTTTGCCTCTGCT
CTCAAGAATAACGAAACAAGACTTTCAATTTCGACTTTTAAAGGATCTTAAGCTTATACT
GCTCCAGAAGTTTACTAAAATGTGTATAAAAAACTGTCTGATTTATTTTCTGTCGGAATT
GTTTTGCTAGAACTTGATAACATAGCAACTTTTGATATCAGTAAAACAAATCTTGAGCAA
AAGTTTGAAACAAAAAATGGATAAATCTTCTAAAACTTCAACATAGATAAATAATCCCAA
ATCTATAAGATAGTCATGCAATGCCTTAAATACGAAGTGGACCAACGTAAACCTGCAGTT
GAGCTTCTAATTTAATTCATTGTTTAAAACTAATAATACTTAAATGTAGATGTTTTTACA
TTATTAAATAAGTCTCAATTAAAGCAGAAAGCTGAGTAGTTTAACCAAATTCAAATGAGC
ATAGTTCAGAAGAAGAAGAAAAATGAGAGTGAAATCTTACAGCTATCTTAGATTTATCAT
AAAGATTTACACTTAGAAAAGCTTATTAAAAAATATGAATAATTGGAAAGAAAGCCCTTC
GAAACTTATGAATATTAAATCATTCTTAATGATTTGCAAAAATTGACTAAATTTGATCCT
AACTTCGAATTCATTTCAGTTGGCGCAACTGGATTAGTTCTCGGGGTATTCAACAAAGCT
TAAAATAGGTACTCAGCTCTTAAAATATAAAGAGCTAAAAAGCATGAAGTAGTCCGCGAA
GTTGGTATCATGAAAGACTGTTAAATGCCTCTAGTCATTAAATTTTATGACTATTTTTAC
TTAAATGTGAATAATAAAGAAGATTTTGTGGTATATGAGATAGAGAAGTGTTCAGGCAAC
TTAAAACAATTCCTCAATAATTTAAAGAAATAAAATAAAGAACTAGATGAAAATCAAAAA
ATAAAAATAGCTATCTAAATCATGGATGTCATTAATTATCTTCATATTCATGATATCGTT
CATAGAGATATCAAATTAGAAAATTTACTCTATGTAGAGTAAGATCCTGAAATTCCAACA
ATTAAATTAGCTGACTTTGATTAAGCCAGAAAAATGCCTTATGATTGGTTGTATATTAAT
GAATAATATGTTAAATAATACTATCCTATTGAAGGAGCTTGCGGAACTATTGGATACTGC
CCACCAGAATTAGTCAAAGATTTCTTATACAGTTTTAATAGTGACATTTTCTAAGTTGGA
GTTTGTCTTGCACTTATAGACAATTTTGAAACTTTAGAACCAGTACTTGTTAACAAAAGT
CTAGATTATTTGAACAACTTTTCAATCCCTTTTGAAGTAAAACAACATAATGAATAAGAA
GTTGTTAAAAGGAATACTAAAATTTATGATATACTGCTTTAAACTATTGTTTTCAAACAA
CATAAACGGTCCAATTTATCCCTTATTCTAGATGGTTTTTCTAAAAAAGGGTACCAATAC
CATTCAAAAGTTAATGCAAAGCCAAATTAAATTATATCATCCATCTATTAAAGGGTTCTT
TCTTTAAATTATTCCAAAAAAAATTTAAGTACAGATGGGGTGAAAGCAGTTGCTTCCGAA
ATAGCTAAATGTACTAATCTCTCTACTTTAAGCCTTTGGCTCTAGTCTAACAACATAGGT
TCAGATGGGGCGAAAGCAGTTGCTTCCGAAATAGCTAAATGTACTAATCTCTCCACTTTA
ACCCTTTCGCTCTATAAGAACAACATAGGTTCAGATGGGGCGAAAGCAGTTGCTTCCGAA
ATAGCTAAATGTACTAATCTCTCCACTTTAAGCCTCGACCTTGGCTATAACAACAACATA
GGTTCAGATGGGGCGAAAGCAGTTGCTTCCGAAATAGCTAAATGTACTAATCTCTCCACT
TTAAGCCTCGACCTCTATAACAACAACATAGGTTCAGATGGGGCGAAAGCAGTTGCTTCC
GAAATAGCTAAATGTACTAATCTCTCCACTTTAACCCTTTGGCTTGGGTCTAACAACATA
GGTTCAGATGGGGCGAAAGCAGTTGCTTCCGAAATAGCTAAATGTACTAATCTCTACACT
TTAAACCTCGATTTCTAGTGGAATAGTATAGGTTCAGATGGGGCGAAAGCAGTTGCTTCC
GAAATAGCTAAATGTACTAATCTCTCCACTTTAACCCTTTGGCTTGGGTCTAACAACATA
GGTTCAGATGGGGCGAAAGCAGTTGCTTCCGAAATAGCTAAATGTACTAATCTCTACACT
TTAAACCTCGATTTCTAGTAATTTTTTACACCTTTTCTCAATTTATTGTTTAAAAAAATA
ATTTAAGAAGCAATATAATTAAACATTAAATATTTATTTGAAAGTACTACCACCAACTGA


>TTHERM_01155710(protein)
MSSSKQVRQEVEKQIKNCIIKKQNVKKFFKLMKKQQKHYQILQFAGNGTFALVLKAINKN
TGQTVALKAVECDESDLKGMEVIQDEYKMLEVFSGCKYIIKVFNSFYLTESIDSDSDEDD
DQIPVDQNNNQSSLLRVFYVMEQEFCQTTLSSFIDTCRQKNSYPSQQMKEIMTIQILDSV
AFLHRFDVVHRDIKPSNFLLNFDQNGNPTLKLCDLAFASALKNNETRLSISTFKGSQAYT
APEVYQNVYKKLSDLFSVGIVLLELDNIATFDISKTNLEQKFETKNGQIFQNFNIDKQSQ
IYKIVMQCLKYEVDQRKPAVELLIQFIVQNQQYLNVDVFTLLNKSQLKQKAEQFNQIQMS
IVQKKKKNESEILQLSQIYHKDLHLEKLIKKYEQLERKPFETYEYQIILNDLQKLTKFDP
NFEFISVGATGLVLGVFNKAQNRYSALKIQRAKKHEVVREVGIMKDCQMPLVIKFYDYFY
LNVNNKEDFVVYEIEKCSGNLKQFLNNLKKQNKELDENQKIKIAIQIMDVINYLHIHDIV
HRDIKLENLLYVEQDPEIPTIKLADFDQARKMPYDWLYINEQYVKQYYPIEGACGTIGYC
PPELVKDFLYSFNSDIFQVGVCLALIDNFETLEPVLVNKSLDYLNNFSIPFEVKQHNEQE
VVKRNTKIYDILLQTIVFKQHKRSNLSLILDGFSKKGYQYHSKVNAKPNQIISSIYQRVL
SLNYSKKNLSTDGVKAVASEIAKCTNLSTLSLWLQSNNIGSDGAKAVASEIAKCTNLSTL
TLSLYKNNIGSDGAKAVASEIAKCTNLSTLSLDLGYNNNIGSDGAKAVASEIAKCTNLST
LSLDLYNNNIGSDGAKAVASEIAKCTNLSTLTLWLGSNNIGSDGAKAVASEIAKCTNLYT
LNLDFQWNSIGSDGAKAVASEIAKCTNLSTLTLWLGSNNIGSDGAKAVASEIAKCTNLYT
LNLDFQQFFTPFLNLLFKKIIQEAIQLNIKYLFESTTTN


>TTHERM_01155710(gene)
ATGTCAAGTTCTAAGTAAGTTAGATAAGAAGTTGAGAAACAAATCAAAAATTGTATCATC
AAGAAGCAAAATGTCAAGAAGTTTTTCAAGTTAATGAAAAAATAGTAAAAGCACTATCAG
ATTTTGCAGTTTGCAGGAAATGGAACTTTTGCATTGGTCCTAAAGGCTATCAACAAAAAT
ACAGGCTAAACAGTGGCTCTTAAAGCTGTAGAATGTGATGAAAGCGACTTAAAAGGGATG
GAAGTTATTCAAGACGAGTACAAAATGCTGGAGGTATTCAGCGGTTGTAAGTATATAATC
AAAGTATTCAACAGTTTCTACCTTACTGAAAGCATCGATTCTGATTCTGATGAAGATGAT
GATTAAATTCCAGTAGACCAAAATAACAACTAATCAAGCTTATTGAGGGTATTCTATGTT
ATGGAATAGGAATTCTGTCAAAGTAATAAACTTCAATAAATTGCTATATATTCCTTTTAA
ATTCATCCTCATTTTAAGATGATTGCGAAGGTTAAAAAAATGTTAAAAAGACATATTTAT
TAATTATTTTTCTTTTGCTTGTTAATTAAATGACAAAATCCAAATCTGAATGAATGTTTA
ATTAAATAGTAAAAATCATTCATTTTGTTATGAATAAATGAATGAATTCGTTTTTTCCTT
TTTCTTATTTTGCTTTTAATTATTCATTCATTTTTAACACTTTTCTAAATTTTGATTTAC
TTTAATGTTAATAATGAATGTAATTCACTGTTAACTAGTAATATTATAAAGAAAGCATTT
AATATCAAAAAATCAATAACTCAATTCAATTTACCTTGTCATTTAACAAGTAAATAAATC
AATAGGCTCTTCATTCATTTTTGAATGATAAAATTGAAAAGATTAATCATAAAAAAATAC
AAATAATAAAGAGATCATTTATTCAATTTATGAATGAGGGTCAATCATTATTATTAATAA
TTTACATACAAAATAAAATAAGAAAATATACATTCATATTTTTAATATTTGCCATTCATT
TTTCAAATAAAATGCCAAACGCATATCTATTCAAATATGAATGACAAAAATAAAATTGCA
ATCACTTTTTTATAATAATATTTTTTTAACAAATGAAATAATATATTTAACTATTTTTTT
AAATAATTTATTAAAAAATATAATGAAATAATAGCTTTAACACAAAAAACATAGATATAT
CTTATATTAAAAAATGTTATTTTTAGATAAAAAAATTAACTTTAAAATAAATAAACAATT
ATAAGAAAAATAAATGAACTTCTCTCATTTTTAAATAGTTCTCAAGATAATTTTATTTAA
TTATTATCAAAATTTAATATAAAAGCTACTCTATCGTCATTCATTGATACATGTAGGCAA
AAAAATAGCTATCCAAGCTAATAAATGAAAGAAATAATGACTATCTAAATCTTAGATTCA
GTAGCTTTTTTGCACAGGTTTGATGTTGTGCATAGAGATATAAAGCCATCAAACTTTTTG
CTTAACTTTGACCAAAACGGCAATCCAACTCTTAAGCTATGTAATATTAATTATTTAAAA
TAAACCATTTTTATACTTTAGAGATATTTAACCAATTTTATTAAGTTGAATTCAAAGTAA
ATCTTAATTATTTTTTATGATAATCCATCAATCCATTGAAATATTAAACAAAAATTAAAT
TAAAACTCCATTAAACTCCCTTAATAAAAATTTTCCTTTTTAATAGGATAATTATTCTTT
TAAAATTTAAAATAAATAAATAAATTTCTAAATAAAGCACAAAAATAGCATTTATTTTAT
AATTTTGGTATCAATTTAAATGATAATTGATGAAAATAGCAGCAATTTAAAAAAAACCTT
GCTGCTATTGTAGTTTTTTGAAATAAATTTCAAGTTTTAATATTTCAAAAAAATTTAAAA
GACTTTAAGACATAAAATAACAATTATTATAAACCAAACTATTCCTCATCATATCTGAAA
CCTAAAATACCATCTTATAAATTGAAATTTATATCAATTAATGCTAAAAATTACATTTTT
TATTTGAACTATCTAAATTTTTTAAAAATACACTTAAAAAAAAGCTTTAAAAGAACTAAA
ATACTAAGAAAATTATATTAAATTATTAATTTTAAAGTGCTTAATTTAGAGTATTAAAGA
AATAACATCAATAAATCCTCACATAATATTAAAATTAATCTGAATATACAGATTAAATTT
AAAATTTAAAGCTTTAATTATCTAAAAGTTTTATTTCATAAAATTTTTTAAAGAAATACA
ACTCTATCAAATATAAATTTTTTAAAAAAATAAGAAAACTGTGCATTTACATGAAAGTGC
AATTTATTTAACCTTAGAAACGATAATATAACAAAACTGTCAATTTTACATAAGATAAAC
TAAAAAAATTAGCATCTATTTGCTAAATAATTTAAATTAAATAAGTTTATTTTGTGAATT
AAGTCATTTTTGCTATTTTGCTTTTCCCTCACAAATAAATACTGAAATAATTCTCAAAAT
TAATAGGAAAATAAAGAATATTTTCAAATTAAAAGATTTTTAATCTATTTTGATTAATAT
TGTATGTCAGAAACAAATTAATCTTCAATCATTCATAGTTAAGACTTAATTACAAAAAAT
TTAAGCATATAACAAAAGATAGAGCTATGCTTAAATACTATTTCTATCATACATAATTTT
TTTAAAAAAAATAATAAGTATCTCTTATTCTTTGAGAATAACTATTATAACAATTTCTGA
TAAATTGTTTTATTTGTTTACTAAAAATATCTATTAAATTTGAATATAAAGAATATCTTC
ACTTGCAATATTATCTTTCTTTTTATTCAGTTTGGTTTTATCATTGAAAAAATTAACTCA
ATGATGCTTAAATCAGGGTTATATGTGGGGAATTAGATATAATTTATTCCAAATCATCAA
GAAAATTCATTGTTTACTATGAAATGTGATCTCCCAATTAGAGGTGGGAATCAGTTTGAA
TTTTAAGACCAATACCTAAAAAAATTTTTTTAATTTATATAAAAAGTTTTATGGATTATT
TTAAATATTAAAAATTTAACAATTTCCATTAATTATATAAAATAGTTAATTTTGTTTAAC
TTTATTTTTCTTTTTTAATAATTACTTTTTTATTATGGTTTTCTTAAATCAATGAAATTT
ACTTTGTTTATCTAAAAAAAAATATTTATATATTAAATTATATCAAAAAGGTGATCTGGC
TTTTGCCTCTGCTCTCAAGAATAACGAAACAAGACTTTCAATTTCGACTTTTGTAATAAA
ATTTTTAAAGAAATGTTTAATTAAATTTCTAACTTAAATTTTAGAAAGGATCTTAAGCTT
ATACTGCTCCAGAAGTTTACTAAAATGTGTATAAAAAACTGGTAACATTAAATTATTTTC
TTTATTTATTTTGGCTTGAAACCGATTTAGTTATTGTCATAATTTTTTGTTATTAAATTC
ATTGTATTTACTAATATTTACTAAATTAAAACTAGTCTGATTTATTTTCTGTCGGAATTG
TTTTGCTAGAACTTGATAACATAGCAACTTTTGATATCAGTAAAACAAATCTTGAGCAAA
AGTTTGAAACAAAAAATGGATAAATCTTCTAAAACTTCAACATAGATAAATAATCCCAAA
TCTATAAGATAGTCATGCAATGCCTTAAATACGAAGTGGACCAACGTAAACCTGCAGTTG
AGCTTCTAATTTAATTCATTGTTTAAAACTAATAATACTTAAATGTAGATGTTTTTACAT
TATTAAATAAGGTAAAATTATTTAGTTTCATATTTTTAAGATTCATTTCATTCATTTCGT
AAAAACTAAAGTCTCAATTAAAGCAGAAAGCTGAGTAGTTTAACCAAATTCAAATGAGCA
TAGTTCAGAAGAAGAAGAAAAATGAGAGTGAAATCTTACAGCTATCTTAGATTTATCATG
TAAATAAATGCTTATAAAATTTTAAATTAATCTTATTTATTATTTTAGAAAGATTTACAC
TTAGAAAAGCTTATTAAAAAATATGAATAATTGGAAAGAAAGCCCTTCGAAACTTATGAA
TATTAAATCATTCTTAATGATTTGCAAAAATTGACTAAATTTGATCCTAACTTCGAATTC
ATTTCAGTTGGCGCAACTGGATTAGTTCTCGGGGTATTCAACAAAGCTTAAAATAGGTAC
TCAGCTCTTAAAATATAAAGAGCTAAAAAGCATGAAGTAGTCCGCGAAGTTGGTATCATG
AAAGACTGTTAAATGCCTCTAGTCATTAAATTTTATGACTATTTTTACTTAAATGTGAAT
AATAAAGAAGATTTTGTGGTATATGAGATAGAGAAGTGTTCAGGTAATTCAAAAAATATA
TTTAATTACTTTACAATCATTTATTTTTTAAATAAACATTATTAAGGCAACTTAAAACAA
TTCCTCAATAATTTAAAGAAATAAAATAAAGAACTAGATGAAAATCAAAAAATAAAAATA
GCTATCTAAATCATGGATGTCATTAATTATCTTCATATTCATGATATCGTTCATAGAGAT
ATCAAATTAGAAAATTTACTCTATGTAGAGTAAGATCCTGAAATTCCAACAATTAAATTA
GGTACTTTACTTACATTTTTTTATTAATTTTAATAATTTTATTTTGAATTTTCTTTTAAA
ATAGCTGACTTTGATTAAGCCAGAAAAATGCCTTATGATTGGTTGTATATTAATGAATAA
TATGTTAAATAATACTATCCTATTGAAGGAGCTGTAAATATACTATTAAAAATTAGTTTA
AATTTATTTTTATTTTTATTTTAAAGTGCGGAACTATTGGATACTGCCCACCAGAATTAG
TCAAAGATTTCTTATACAGTTTTAATGTATGATCATAATATCTAAAATTATTTTTAAGAC
TTATTTTTTATAAAGAGTGACATTTTCTAAGTTGGAGTTTGTCTTGCACTTATAGACAAT
TTTGAAACTTTAGAACCAGTACTTGTTAACAAAAGTCTAGATTATTTGAACAACTTTTCA
ATCCCTTTTGAAGTAAAACAACATAATGAATAAGAAGTTGTTAAAAGGAATACTAAAATT
TATGATATACTGCTTTAAACTATTGTTTTCAAACAACATAAACGGTCCAATTTATCCCTT
ATTCTAGATGGTTTTTCTAAAAAAGGGTACCAATACCATTCAAAAGTTAATGCAAAGCCA
AATTAAGTATTTATAATTAATATATTCATGCCCATTAATTATTTCAAATTATTAATTAGA
TTATATCATCCATCTATTAAAGGGTTCTTTCTTTAAATTATTCGTAAATATTTATCATCT
TTTAATCTTAAATATTTTTATGTTTTATGATATTTAGATTAATTCATATTTAAAAAGCAA
AAAAAATTTAAGTACAGATGGGGTGAAAGCAGTTGCTTCCGAAATAGCTAAATGTACTAA
TCTCTCTACTTTAAGCCTTTGGCTCTAGTAATTTTTTACACATTTTCTCAATTTATAGTT
TAAATAAATAATTAAAGAAATCAAAGAATTAAACAATATTTATTTATTTAATTAATTAAT
TAAGTATTTTTGTTAATTTTAATTAGGTCTAACAACATAGGTTCAGATGGGGCGAAAGCA
GTTGCTTCCGAAATAGCTAAATGTACTAATCTCTCCACTTTAACCCTTTCGCTCTAGTAA
TTTTTTACACATTTTCTCAATTTATAGTTTAAATAAATAATTAAAGAAATCAAAGAATTA
AACAATATTTATTTATTTAATTAATTAAGTATTTTTGTTAATTTTAATTAGTAAGAACAA
CATAGGTTCAGATGGGGCGAAAGCAGTTGCTTCCGAAATAGCTAAATGTACTAATCTCTC
CACTTTAAGCCTCGACCTTGGGTAATTTTTTACACATTTTCTCAATTTATAGTTTAAATA
AATAATTAAAGAAATCAAAGAATTAAACAATATTTATTTATTTAATTAATTAAGTATTTT
TGTTAATTTTAATTAGCTATAACAACAACATAGGTTCAGATGGGGCGAAAGCAGTTGCTT
CCGAAATAGCTAAATGTACTAATCTCTCCACTTTAAGCCTCGACCTCTAGTAATTTTTTA
CACATTTTCTCAATTTATAGTTTAAATAAATAATTAAAGAAATCAAAGAATTAAACAATA
TTTATTTATTTAATTAATTAAGTATTTTTGTTAATTTTAATTAGTAACAACAACATAGGT
TCAGATGGGGCGAAAGCAGTTGCTTCCGAAATAGCTAAATGTACTAATCTCTCCACTTTA
ACCCTTTGGCTTGGGTAATTTTTTACACATTTTCTCAATTTATAGTTTAAATAAATAATT
AAAGAAATCAAAGAATTAAACAATATTTATTTATTTAATTAATTAATTAAGTATTTTTGT
TAATTTTAATTAGGTCTAACAACATAGGTTCAGATGGGGCGAAAGCAGTTGCTTCCGAAA
TAGCTAAATGTACTAATCTCTACACTTTAAACCTCGATTTCTAGTAATTTTTTACACCTT
TTCTCAATTTATAGTTTAAATAAATAATTAAAGAAATCAAAGAATTAAATAATATTTATT
TAATTAATTAATAAAGTATTTTTGTTAATTTTAATTAGGTGGAATAGTATAGGTTCAGAT
GGGGCGAAAGCAGTTGCTTCCGAAATAGCTAAATGTACTAATCTCTCCACTTTAACCCTT
TGGCTTGGGTAATTTTTTACACATTTTCTCAATTTATAGTTTAAATAAATAATTAAAGAA
ATCAAAGAATTAAACAATATTTATTTATTTAATTAATTAATTAAGTATTTTTGTTAATTT
TAATTAGGTCTAACAACATAGGTTCAGATGGGGCGAAAGCAGTTGCTTCCGAAATAGCTA
AATGTACTAATCTCTACACTTTAAACCTCGATTTCTAGTAATTTTTTACACCTTTTCTCA
ATTTATTGTTTAAAAAAATAATTTAAGAAGCAATATAATTAAACATTAAATATTTATTTG
AAAGTACTACCACCAACTGA