Identifiers and Description

Gene Model Identifier

TTHERM_00157890

Standard Name

LRC1 (Fusion of a protein phosphatase and ER-golgi vesicle tethering protein.)

Aliases

PreTt28379 | 13.m00338 | 3829.m01190

Description

Fusion of a protein phosphatase and ER-golgi vesicle tethering protein.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF02524 ) KID repeat
  • ( PF01576 ) Myosin tail
  • ( PF02370 ) M protein repeat
  • ( PF00904 ) Involucrin repeat
  • ( TIGR01612 ) rhoptry protein
  • ( PF00560 ) Leucine Rich Repeat
  • ( PF07725 ) Leucine Rich Repeat
  • ( TIGR00293 ) prefoldin, alpha subunit
  • ( PF00038 ) Intermediate filament protein
  • ( PF08946 ) Osmosensory transporter coiled coil
  • ( PF08385 ) Dynein heavy chain, N-terminal region
  • ( TIGR00162 ) conserved hypothetical protein TIGR00162
  • ( PF02197 ) Regulatory subunit of type II
  • ( TIGR01442 ) small, acid-soluble spore protein, gamma-type

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00157890

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05255.19.997093137033517e-262hypothetical protein (1719 aa)
Stentor CoeruleusSteCoe_362850.000000000000001713908431542013
OxytrichaContig1132.0.g110.000000000010004361180063202Leucine Rich repeats (2 copies
)
SGDYKL193C0.00000009004106436083642SDS22 Conserved nuclear regula
tory subunit of Glc7p type 1 p
rotein serine-threonine phosph
atase (PP1), functions positiv
ely with Glc7p to promote deph
osphorylation of nuclear subst
rates required for chromosome
transmission during mitosis

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00157890(coding)
ATGAAAACTTTGAGCAGAAACAATAGTGAAAAAAGAAAAAGAGACTCTGAAAGCGATTAA
AAGGCAGGAGTCATTAGGATAAATGAGGCTCTCATTAAATAAGTTACAAATCAAAGTGAT
TTCTCATAGATCAAAGCACTTAATTTTCATATTAGATTGAATAATAATTCAAAAATATAA
AGACTAGAAGGATTGGATGATCTAGTTAATTTATAAGAGCTTAACCTTAGTTATAATAGC
ATTTAAAAAATTGAGAATTTGGCTCGTTTGCAAAATCTGAGAGAACTCAATTTAGCGGAA
AATAATATATCAAGATTAGAAGGCCTAGAGATGCTTAAGAATATAGAAAATATAAATCTT
AATGGAAATAGTATAGTTGAGTTACCAATAGATATCCTAAAAAATTTATAAAGGTTAAGA
GTGTTAAAGTTGACAAGAAATAAAGTTAAAGAGTTAGGATAGGTTTAAAATTTAAGTGTG
TTGAGTAGTCTCGAAAGTCTTTCCATAAGCGAAAATCCATTCTGTAAATCTATAACATAT
CAAGAATTTTGCATTTATGCCATGACTAGCTTGAAGGTTTTAGATTCTAAAAAAATAGAT
GAAGACTAAAGGAAGAATGCTTTGTTTTTATTCTCTAGCGGCTTGTAGAATAAATAGGGA
AAGAATTAAGGAAATAATCCTTAAAGTAGTGCTCGTGATGATGTAAGCATGATAAAAAAG
CAAATTGAGTAAGCTAATCAGCAAAGAGACTAATTATCATATGAAAATTAATACTTAAAA
GAAGAGAGAGATTAGTTAAATTAGTAAATTGAGGGCTTAAATGAAAGATTTTAGATTAAA
TTAAGGGAAAATTCTGCTTTTAGTGAAAAAATTGCTAAATTAGAGGCAGAGCTTTAAAAT
TACAAAATTGATGACTTATTTTAATCTTTTAAAGATACGAGAAACTTTGATCTAAATAAG
TTAATGGATATTTAGAATACTTAAAATTTAGTAGAATTTGACAATTAATATTTCAATAAG
CTAGAATAAAAATCAAAAGATCTCCACGAAAAAAGAGAAGAATACCTATTTAAAATAGAA
AATTTAGAAGCCTAGTGTGAAAGGTTAAAAGAAAGAATCATAGAAAGAGAAAAAGAAATG
AACTAAGCAGCTGAATCTTACTTTCAGATGAAGAATCAAATTAGAATGAATAGCAATGTT
AAGTTTATGAAAGACTCATTCATGCCTGACTCAGATGACTTAGAAATCCTTATCAAATAA
AAGGAAGCAAAACTTGCCTTTCATTACAATGAAAATGAAAAGCTAAGATTTGCTAATAGT
GAACTTTAGAGAGAAATTGATTTGACAAGGGAAAAAATAGATAAGACTAGAATTTTGATT
AATAAATTAGATGCTATTAATGATGGAGAAAGTACTTCTAGTGAGGTTGAGGATGAGAGA
GTTCTTTTAGATAAGAAAATAAATTCTCTTTATCAAAAATTAACTTCTTAGTAAGAAAAG
AATAATGAAATAATTCATTTAATTACATCTATTAATAATGAAGTTAATTTTTTAAGCTCT
GAGATTGAGGATTTAAAAAAGTAAAGGTAAGAGAGCTACTTAAAACCTTAGAAGACAGTA
AAAACAAACGAATCTGAAAGTGTTGGATTAGATAATGAAAAACTTAAGGAACTAAGCAAT
AACATAACGTTTTTCTAAAATGAAATTAATTTAATGAAGGAAAAATTAGAAGATAATTAA
AAAGTCTTAAAAGAATTTCATATTTTACTGTAAAAAAATTAATCTGAAATTGATATTTTG
GAATCACAGAAATAATAAATTTAAAATAACTTTAAAGCAAGCACATTTGTCAATAATTTA
AGCAACAGTTTCAAAAAGACTGTTTAAAACTAGTTAAATAATGCTGCTAATAACCTTTAA
AATATTGTTCACGTGCTTAAGACTAAGGCTCCAAAGGTTTTAAATAAAAAATTATCTATT
ATTAATAAAATAGAGTAATAAGTTAACTCAGTTGCTGCTGACCCTTAGATTGACAATTTT
TCTTAGTGCTTAGCTGACTTGAGTGGTGCTATAAGGTTTATCTTTGAGGAAATGGATGAC
TATAAAATTGAACAAGGCGTTATTTTTGATGAGTAAACAAACTAAAAGCGCAAAGAATTT
TATCACTTACAACAATAAATTGATGATTACCAATAAGATAAGTAAAGGTGCTTTGATCAA
ATCAACACTTTATATAAAGAATATATTTATGATCAAGTTAATAACGCTGCTAAAAAGAAA
AAATACAAATCAGGATAAGATGAGTATAATTTTCCAGAGAAATTTGAAAGCTTTGAAGAC
ATGCAATAAGTCTTTAAAATTATTTAAAAACTAATGAAAAATGTAGAAAAAAACGAGTTA
ACAATTAAGAATTTTAATGAAGTCAAATAAAAATTCTTAGACGAGTTTGAAAAAGAGACT
TAAGAGTTATCACAAAAATGGAGAGAATTTGAGTCAAAAAAATTAGAACATAAGTCTAAG
ATAAATAAAGAAAGAGAATAGCTATATTAGTAATTAGAACAAGAATATGAGAAGGTCAAA
TCAGAGAGAGAAGCTATCAAAAATGATCGTTAAAGATTTTATGAAGAGTAAGAAAATTAC
TTTTTAAGTCAACAAAAAAATAAAGAAAAAGAGGAAAACGATAAATTTACTGTTATCAAA
GATGTTGAAGATTAAAGATAGCTTAAATAGAATTTAGAAATGGAAATTTATTAACTTAAA
TCTCATTTAACTCGTCTTTAGAGTGCTTCTGATGAAACAGAAGCTAAAAGAAGTGTAGCA
GAGAAAGATCTTTAAAGAATACTTCAGTAAATTTAAAAGGAGACAGAGAAAGTTTTAAGC
TAGAATGAGTCTAAAGAAAAGTAGCACAAAATACAGCATGTCTTTGAAGAAAGCATAAAC
AAACTTAACTAAGAAAATGAAAGACTTTAAAATATTAATTAATAACTATAAGCTTAAAAG
CAAGAATTGCAATCAGAAGTTTAAAAATTTGAAGTCGATATGAAAATAATAATCTAAAAG
TTTGAGGGAGAGGAAACAATTTACAAACAAAAGCTGAAAGAACTTGAAAGCAGCATTCAA
GAAAAAAGAAAAATTTTATATTCTATAGAGTAAACTTTAAATGACAAGGAGATAAATATT
AACAGAGTTGATAGCCTTTTAGAGGAATATGAAAATACAAAAGAAAAATACAAACAAATT
AAAATGGAAAGCTTGAATTTAGAAAAATAAATTGAAGAAGGTAAAATAAAACTAGACGAA
AATGAAATGAAAATTAAAATGCAGTAAAATTAACTAACTTCCCTAAAAAAGCATCTTGAG
AGTCTTAGTTCTTTGTCTAAGCAGAAGCAGCAAGAAGTTATTTCATTAGAAAAGCAATAC
AGTGACATTTAGTAGCAATTGCTTGATGCTGAGCTTAAAATCTAAAAACTTGATGGATAA
TAATAATATTATATAGAAGAGATGAATAAAATTGAAAAATCAAGAACAGAAAAGAGAAAA
GATTTGCAAATCTTAGAAAAGCAGGTGCATGATAAAGACCTAGAACTTTAAAGTATTAGT
TTGAAGCTTGAGCATGTTAAATAAGAATATGAAGTAAAGCAAAAAGAACTTCAGGAAATT
AGACAAACATATTAATTGGATGAAAAGAAATTTAAGTCCTTAATGGAAGAAAATCACAAT
ACTCTTTAACAGCTTAGAGAAACAATTGAAGAAAGAGAGCAACAATATTATAATCTAAGC
AAAAAAAGAGAATAGCTCGAAAACACCGAAAAATAAAAATAAGATAACCTGTAAAATTTA
ATAAGCTCCTCTAATGAGAGAGAGCATTAGTTGAAAATTTTAAATCAACAAGTAGATAGC
ATGTCCGAAGAATAAAACCTTCTTGCTAATAGATTACAAGAATTGTCAAGCATCCAATCT
AAACTAATTGATGATAACACAATCTTGGAAGAAAGGAGATAGGAATTAAATGATTAAGTG
AATGATTTGGAATAATATGCTGAAGAATTAAAAGATGAATAAAAAGATATTTTAGAAAGA
ATCAAAACGTTGACTAAGAAGGAAGAAACAATTTATATTAATAAGGCTTTCAGTGGAGAA
GAATTAGATAAAGATATTTAATTAAAGATAGAATAAATAATAGAAAGCTATTATGCTAAT
TAAAATAAGGATGAAGAGATTGAATAGCTGAATAAATAAATCAAATAACTAAAGCTAGAA
AGTGAAAATTATAAGAATATTTTAAATTCTAAAAACCACCAAATTATTTCTCAGTCTTAA
TAGAAAGCACAATTAAACAGTAAAAATGCTAATTATCAGAACAACTTAAATTCAACAGGT
AAATTGGGTATAGGATAATCCTCTTCTTTAAAAAATATATAAAAATAAAATCAATTATCT
ACATAAAATTAAGAGAATGAGATTTAGTCTAATTCTAAATTTTAACTTGATACCTTTGCT
AATAAAAATGGTTTTATGGGATTAAGCACTCTTGCCAATAATAATATGATGATGATTTAA
AATGATAATGAGTCTCTACTTTTATCAAGTGATAATAAATACAAAAATTTAGTAACTAGT
ATTCAACAAAAAAATAATCAGGATTTATTGAATGAACTCAATTCATAGAGATTAAAATAA
GTTAAAACTGGCTAATAAGATAATCCTTTCCTAAGAAAGTTATAATAGCAACTTGAATTA
GAAGCCACTCCTGAAAAATAAAAAAGCTAAGATAACCTATTAGATGATAATCTTTTTTCC
TCTAATAATAATCCAGCAGGCTATTCAGCTTCAAAAGCTTCATAGAATAACTCATATAAA
AAGCCAATTTCAACTATTTAGGAACTTTAGCAGCAAGAATCTGCTAATATAAATAAAAGT
CCTTATTATATAAATTAAGAATAAAAATAAAATCCTAGATCAGACAATTCTTCTAATTAG
AAATAAAAACATTAATCTTCAGTAGATAAAATATACCAAGAGTTAGAAGAAGCAGATAGA
CAGCTTTTATAGCTTCAAGATTAGAATGAAATAAAAAACTTGATGGAATCTTCTCAATCT
GAAGACAATAGCTAAAAAAAATAAAATGAATAATATTAAAGAGAGTAATAAGAAGAAGAA
GAATAGTATTAAGGATAATAAGAACAATAAGATTACGACTTTTTAGGAGAAGAATAATTT
TAAGATGAAGATAATGAATTTAATTGA


>TTHERM_00157890(protein)
MKTLSRNNSEKRKRDSESDQKAGVIRINEALIKQVTNQSDFSQIKALNFHIRLNNNSKIQ
RLEGLDDLVNLQELNLSYNSIQKIENLARLQNLRELNLAENNISRLEGLEMLKNIENINL
NGNSIVELPIDILKNLQRLRVLKLTRNKVKELGQVQNLSVLSSLESLSISENPFCKSITY
QEFCIYAMTSLKVLDSKKIDEDQRKNALFLFSSGLQNKQGKNQGNNPQSSARDDVSMIKK
QIEQANQQRDQLSYENQYLKEERDQLNQQIEGLNERFQIKLRENSAFSEKIAKLEAELQN
YKIDDLFQSFKDTRNFDLNKLMDIQNTQNLVEFDNQYFNKLEQKSKDLHEKREEYLFKIE
NLEAQCERLKERIIEREKEMNQAAESYFQMKNQIRMNSNVKFMKDSFMPDSDDLEILIKQ
KEAKLAFHYNENEKLRFANSELQREIDLTREKIDKTRILINKLDAINDGESTSSEVEDER
VLLDKKINSLYQKLTSQQEKNNEIIHLITSINNEVNFLSSEIEDLKKQRQESYLKPQKTV
KTNESESVGLDNEKLKELSNNITFFQNEINLMKEKLEDNQKVLKEFHILLQKNQSEIDIL
ESQKQQIQNNFKASTFVNNLSNSFKKTVQNQLNNAANNLQNIVHVLKTKAPKVLNKKLSI
INKIEQQVNSVAADPQIDNFSQCLADLSGAIRFIFEEMDDYKIEQGVIFDEQTNQKRKEF
YHLQQQIDDYQQDKQRCFDQINTLYKEYIYDQVNNAAKKKKYKSGQDEYNFPEKFESFED
MQQVFKIIQKLMKNVEKNELTIKNFNEVKQKFLDEFEKETQELSQKWREFESKKLEHKSK
INKEREQLYQQLEQEYEKVKSEREAIKNDRQRFYEEQENYFLSQQKNKEKEENDKFTVIK
DVEDQRQLKQNLEMEIYQLKSHLTRLQSASDETEAKRSVAEKDLQRILQQIQKETEKVLS
QNESKEKQHKIQHVFEESINKLNQENERLQNINQQLQAQKQELQSEVQKFEVDMKIIIQK
FEGEETIYKQKLKELESSIQEKRKILYSIEQTLNDKEININRVDSLLEEYENTKEKYKQI
KMESLNLEKQIEEGKIKLDENEMKIKMQQNQLTSLKKHLESLSSLSKQKQQEVISLEKQY
SDIQQQLLDAELKIQKLDGQQQYYIEEMNKIEKSRTEKRKDLQILEKQVHDKDLELQSIS
LKLEHVKQEYEVKQKELQEIRQTYQLDEKKFKSLMEENHNTLQQLRETIEEREQQYYNLS
KKREQLENTEKQKQDNLQNLISSSNEREHQLKILNQQVDSMSEEQNLLANRLQELSSIQS
KLIDDNTILEERRQELNDQVNDLEQYAEELKDEQKDILERIKTLTKKEETIYINKAFSGE
ELDKDIQLKIEQIIESYYANQNKDEEIEQLNKQIKQLKLESENYKNILNSKNHQIISQSQ
QKAQLNSKNANYQNNLNSTGKLGIGQSSSLKNIQKQNQLSTQNQENEIQSNSKFQLDTFA
NKNGFMGLSTLANNNMMMIQNDNESLLLSSDNKYKNLVTSIQQKNNQDLLNELNSQRLKQ
VKTGQQDNPFLRKLQQQLELEATPEKQKSQDNLLDDNLFSSNNNPAGYSASKASQNNSYK
KPISTIQELQQQESANINKSPYYINQEQKQNPRSDNSSNQKQKHQSSVDKIYQELEEADR
QLLQLQDQNEIKNLMESSQSEDNSQKKQNEQYQREQQEEEEQYQGQQEQQDYDFLGEEQF
QDEDNEFN


>TTHERM_00157890(gene)
ATGAAAACTTTGAGCAGAAACAATAGTGAAAAAAGAAAAAGAGACTCTGAAAGCGATTAA
AAGGCAGGAGTCATTAGGATAAATGAGGCTCTCATTAAATAAGTTACAAATCAAAGTGAT
TTCTCATAGATCAAAGCACTTAATTTTCATATTAGATTGAATAATAATTCAAAAATATAA
GTAAATAAATAAATAAATACATTAGCAAATGGTATTGAATTTATCAAAATAAAATTATAA
TATAATAGAGACTAGAAGGATTGGATGATCTAGTTAATTTATAAGAGCTTAACCTTAGTT
ATAATAGCATTTAAAAAATTGAGAATTTGGCTCGTTTGCAAAATCTGAGAGAACTCAATT
TAGCGGAAAATAATATATCAAGATTAGAAGGCCTAGTAAACAATTTTATATTTATTTATC
TGCAAACAATATATTTCAATATAATGATAATTAATGTCTTTAACTAATATGCAATTAGGA
GATGCTTAAGAATATAGAAAATATAAATCTTAATGGAAATAGTATAGTTGAGTTACCAAT
AGATATCCTAAAAAATTTATAAAGGTTAAGAGTGTTAAAGTTGACAAGAAATAAAGTTAA
AGAGTTAGGATAGGTTTAAAATTTAAGTGTGTTGAGTAGTCTCGAAAGTCTTTCCATAAG
CGAAAATCCATTCTGTAAATCTATAACATATCAAGAATTTTGCATTTATGCCATGACTAG
CTTGAAGGTAAAATAAATAAGCATCAAATTTCTTTAATTGTATTAAAATTCAAATATTAA
TTTTTTAAAATAATACTTTTTTTCAGTGCTTTTAAAACAAATATGTTTTATTATAGGTTT
TAGATTCTAAAAAAATAGATGAAGACTAAAGGAAGAATGCTTTGTTTTTATTCTCTAGCG
GCTTGTAGAATAAATAGGGAAAGAATTAAGGAAATAATCCTTAAAGTAGTGCTCGTGATG
ATGTAAGCATGATAAAAAAGCAAATTGAGTAAGCTAATCAGCAAAGAGACTAATTATCAT
ATGAAAATTAATACTTAAAAGAAGAGAGAGATTAGTTAAATTAGTAAATTGAGGGCTTAA
ATGAAAGATTTTAGATTAAATTAAGGGAAAATTCTGCTTTTAGTGAAAAGTAGCTTAAAA
ATCTCCTATTCATATTCTAACAATTTTTTTATATAATGTAGAATTGCTAAATTAGAGGCA
GAGCTTTAAAATTACAAAATTGATGACTTATTTTAATCTTTTAAAGATACGAGAAACTTT
GATCTAAATAAGTTAATGGATATTTAGAATACTTAAAATTTAGTAGAATTTGACAATTAA
TATTTCAATAAGCTAGAATAAAAATCAAAAGATCTCCACGAAAAAAGAGAAGAATACCTA
TTTAAAATAGAGTAAAATTATTGATCCTAAAATTTAAACTTATTGTATTTCTAACGAAAG
AAATTTAGAAGCCTAGTGTGAAAGGTTAAAAGAAAGAATCATAGAAAGAGAAAAAGAAAT
GAACTAAGCAGCTGAATCTTACTTTCAGATGAAGAATCAAATTAGAATGAATAGCAATGT
TAAGTTTATGAAAGACTCATTCATGCCTGACTCAGATGACTTAGAAATCCTTATCAAATA
AAAGGAAGCAAAACTTGCCTTTCATTACAATGAAGTACAAATCATTGTTTTTTATTTTTT
GTTAAAATTTTTCAATAAGCATTTTATCATTTATAATTAAATTAATATTTAAGAATAAAA
TAAACATTAGAAATAAAATTAAGAATGCTTTTAAATTTAAATTTATAAAATAAAGAGTTG
AATTATTCAACAAGCAAGCTTTAGTTAATTCATCAATCAATATTCAAAAATTTTTAAAAA
TTTTATTTAAATATAATAAGAATGAAAAGCTAAGATTTGCTAATAGTGAACTTTAGAGAG
AAATTGATTTGACAAGGGAAAAAATAGATAAGACTAGAATTTTGATTAATAAATTAGATG
CTATTAATGATGGAGAAAGTACTTCTAGTGAGGTTGAGGATGAGAGAGTTCTTTTAGATA
AGAAAATAAATTCTCTTTATCAAAAATTAACTTCTTAGTAAGAAAAGAATAATGAAATAA
TTCATTTAATTACATCTATTAATAATGAAGTATTTTTATTTAAATTTGTATTAAAATAAT
AATTTTAAATTAATTTAATAATTTCTAGGTTAATTTTTTAAGCTCTGAGATTGAGGATTT
AAAAAAGTAAAGGTAAGAGAGCTACTTAAAACCTTAGAAGACAGTAAAAACAAACGAATC
TGAAAGTGTTGGATTAGATAATGAAAAACTTAAGGAACTAAGCAATAACATAACGTTTTT
CTAAAATGAAATTAATTTAATGAAGGAAAAATTAGAAGATAATTAAAAAGTCTTAAAAGA
ATTTCATATTTTACTGTAAAAAAATTAATCTGAAATTGATATTTTGGAATCACAGAAATA
ATAAATTTAAAATAACTTTAAAGCAAGCACATTTGTCAATAATTTAAGCAACAGTTTCAA
AAAGACTGTTTAAAACTAGTTAAATAATGCTGCTAATAACCTTTAAAATATTGTTCACGT
GCTTAAGACTAAGGCTCCAAAGGTTTTAAATAAAAAATTATCTATTATTAATAAAATAGA
GTAATAAGTTAACTCAGTTGCTGCTGACCCTTAGATTGACAATTTTTCTTAGTGCTTAGC
TGACTTGAGTGGTGCTATAAGGTTTATCTTTGAGGAAATGGATGACTATAAAATTGAACA
AGGCGTTATTTTTGATGAGTAAACAAACTAAAAGCGCAAAGAATTTTATCACTTACAACA
ATAAATTGATGATTACCAATAAGATAAGTAAAGGTGCTTTGATCAAATCAACACTTTATA
TAAAGAATATATTTATGATCAAGTTAATAACGCTGCTAAAAAGAAAAAATACAAATCAGG
ATAAGATGAGTATAATTTTCCAGAGAAATTTGAAAGCTTTGAAGACATGCAATAAGTCTT
TAAAATTATTTAAAAACTAATGAAAAATGTAGAAAAAAACGAGTTAACAATTAAGAATTT
TAATGAAGTCAAATAAAAATTCTTAGACGAGTTTGAAAAAGAGACTTAAGAGTTATCACA
AAAATGGAGAGAATTTGAGTCAAAAAAATTAGAACATAAGTCTAAGATAAATAAAGAAAG
AGAATAGCTATATTAGTAATAATTATTAATTACTTCAAATAATAATTGCAATTAAAAAAA
ATAGGTAATTAGAACAAGAATATGAGAAGGTCAAATCAGAGAGAGAAGCTATCAAAAATG
ATCGTTAAAGATTTTATGAAGAGTAAGAAAATTACTTTTTAAGTCAACAAAAAAATAAAG
AAAAAGAGGAAAACGATAAATTTACTGTTATCAAAGATGTTGAAGATTAAAGATAGCTTA
AATAGAATTTAGAAATGGAAATTTATTAACTTAAATCTCATTTAACTCGTCTTTAGAGTG
CTTCTGATGAAACAGAAGCTAAAAGAAGTGTAGCAGAGAAAGATCTTTAAAGAATACTTC
AGTAAATTTAAAAGGAGACAGAGAAAGTTTTAGTAATATTTAAATTCTAACTTTTTTAAT
TGATTTAAATTATTTTTTAAAGAGCTAGAATGAGTCTAAAGAAAAGTAGCACAAAATACA
GCATGTCTTTGAAGAAAGCATAAACAAACTTAACTAAGAAAATGAAAGACTTTAAAATAT
TAATTAATAACTATAAGCTTAAAAGCAAGAATTGCAATCAGAAGTTTAAAAATTTGAAGT
CGATATGAAAATGTAAAATATATTTTATAAAAAATCAATCAGATAGTCTAACTTTTTATT
AGAATAATCTAAAAGTTTGAGGGAGAGGAAACAATTTACAAACAAAAGCTGAAAGAACTT
GAAAGCAGCATTCAAGAAAAAAGAAAAATTTTATATTCTATAGAGTAAACTTTAAATGAC
AAGGAGATAAATATTAACAGAGTTGATAGCCTTTTAGAGGAATATGAAAATACAAAAGAA
AAATACAAACAAATTAAAATGGAAAGCTTGAATTTAGAAAAATAAATTGAAGAAGGTAAA
ATAAAACTAGACGAAAATGAAATGAAAATTAAAATGCAGTAAAATTAACTAACTTCCCTA
AAAAAGCATCTTGAGAGTCTTAGTTCTTTGTCTAAGCAGAAGCAGCAAGAAGTTATTTCA
TTAGAAAAGCAAGTATTCTTCATAATTATTTTTGTTATCACTTAATGAGTTTTATAAATT
AAACTAAATAGTACAGTGACATTTAGTAGCAATTGCTTGATGCTGAGCTTAAAATCTAAA
AACTTGATGGATAATAATAATATTATATAGAAGAGATGAATAAAATTGAAAAATCAAGAA
CAGAAAAGAGAAAAGATTTGCAAATCTTAGAAAAGCAGGTGCATGATAAAGACCTAGAAC
TTTAAAGTATTAGTTTGAAGCTTGAGCATGTTAAATAAGAATATGAAGTAAAGCAAAAAG
AACTTCAGGAAATTAGACAAACATATTAATTGGATGAAAAGAAATTTAAGTCCTTAATGG
AAGAAAATCACAATACTCTTTAACAGCTTAGAGAAACAATTGAAGAAAGAGAGCAACAAT
ATTATAATCTAAGCAAAAAAAGAGAATAGCTCGAAAACACCGAAAAATAAAAATAAGATA
ACCTGTAAAATTTAATAAGCTCCTCTAATGAGAGAGAGCATTAGTTGAAAATTTTAAATC
AACAAGTAGATAGCATGTCCGAAGAATAAAACCTTCTTGCTAATAGATTACAAGAATTGT
CAAGCATCCAATCTAAACTAGTAAAATCTTCTTCAATTCTTCAGACCTAACAATCTATTT
ATTAAAAAAAGATCAAAAAATAAATACATTTTTTTCTTAGAAAAATATATTTTTTATTTT
TATTTTTTAAATAGTTTCCTTTAAAAAATAATTAAATTCTTAATTGAAGATAAACTAAAA
AATCAATTTTAATCATAATTTAAATGAATTTGATCCAATTTTTTTCAAACAAATTTGAAA
TTTCTAATTTGTAAAAATAAAATTGTAATATAAAATAATGAATAATTTAAATATTAAATT
TAATAAAATTAACATTTTTAAATAAATTTATTGTTTTATTAATTTTTTTTACAAAATTAG
ATTGATGATAACACAATCTTGGAAGAAAGGAGATAGGAATTAAATGATTAAGTGAATGAT
TTGGAATAATATGCTGAAGAATTAAAAGATGAATAAAAAGATATTTTAGAAAGAATCAAA
ACGTTGACTAAGAAGGAAGAAACAATTTATATTAATAAGGCTTTCAGTGGAGAAGAATTA
GATAAAGATATTTAATTAAAGATAGAATAAATAATAGAAAGCTATTATGCTAATTAAAAT
AAGGATGAAGAGATTGAATAGCTGAATAAATAAATCAAATAACTAAAGCTAGAAAGTGAA
AATTATAAGAATATTTTAAATTCTAAAAACCACCAAATTATTTCTCAGTCTTAATAGAAA
GCACAATTAAACAGTAAAAATGCTAATTATCAGAACAACTTAAATTCAACAGGTAAATTG
GGTATAGGATAATCCTCTTCTTTAAAAAATATATAAAAATAAAATCAATTATCTACATAA
AATTAAGAGAATGAGATTTAGTCTAATTCTAAATTTTAACTTGATACCTTTGCTAATAAA
AATGGTTTTATGGGATTAAGCACTCTTGCCAATAATAATATGATGATGATTTAAAATGAT
AATGAGTCTCTACTTTTATCAAGTGATAATAAATACAAAAATTTAGTAACTAGTATTCAA
CAAAAAAATAATCAGGATTTATTGAATGAACTCAATTCATAGAGATTAAAATAAGTTAAA
ACTGGCTAATAAGATAATCCTTTCCTAAGAAAGTTATAATAGCAACTTGAATTAGAAGCC
ACTCCTGAAAAATAAAAAAGCTAAGATAACCTATTAGATGATAATCTTTTTTCCTCTAAT
AATAATCCAGCAGGCTATTCAGCTTCAAAAGCTTCATAGAATAACTCATATAAAAAGCCA
ATTTCAACTATTTAGGAACTTTAGCAGCAAGAATCTGCTAATATAAATAAAAGTCCTTAT
TATATAAATTAAGAATAAAAATAAAATCCTAGATCAGACAATTCTTCTAATTAGAAATAA
AAACATTAATCTTCAGTAGATAAAATATACCAAGAGTTAGAAGAAGCAGATAGACAGCTT
TTATAGCTTCAAGATTAGAATGAAATAAAAAACTTGATGGAATCTTCTCAATCTGAAGAC
AATAGCTAAAAAAAATAAAATGAATAATATTAAAGAGAGTAATAAGAAGAAGAAGAATAG
TATTAAGGATAATAAGAACAATAAGATTACGACTTTTTAGGAGAAGAATAATTTTAAGAT
GAAGATAATGAATTTAATTGA