Identifiers and Description

Gene Model Identifier

TTHERM_00348170

Standard Name

LIG1 (DNA ligase I )

Aliases

PreTt05229 | 36.m00193 | 3703.m00026

Description

homolog to human LIG1

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( TIGR02776 ) DNA ligase D
  • ( PF04675 ) DNA ligase N terminus
  • ( PF01068 ) ATP-dependent DNA ligase domain
  • ( TIGR01725 ) phage protein, HK97 gp10 family
  • ( TIGR00574 ) DNA ligase I, ATP-dependent (dnl1)
  • ( TIGR02779 ) DNA polymerase LigD, ligase domain
  • ( PF01331 ) mRNA capping enzyme, catalytic domain
  • ( PF04679 ) ATP dependent DNA ligase C

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00348170

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09734.19.997093137033517e-262DNA ligase I (816 aa)
OxytrichaContig887.1.g619.997093137033517e-262ATP dependent DNA ligase domai
n
DictyBaseDDB_G02744931.9999565133760522e-166lig1 on chromosome: 2 position
4400712 to 4404415
SGDYDL164C1.0002534232488231e-144CDC9 DNA ligase found in the n
ucleus and mitochondria, an es
sential enzyme that joins Okaz
aki fragments during DNA repli
cation; also acts in nucleotid
e excision repair, base excisi
on repair, and recombination
WormBaseWBGene000029852.0002124324463154e-144locus:lig-1 DNA ligase 1 s
tatus:Partially_confirmed Un
iProt:Q27474 protein_id:CAA9
8242.2
Stentor CoeruleusSteCoe_127740.00000000027894680928689246

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00348170(coding)
ATGAAGCAAGGTACCATTAAAAACTTCTTTGGAAATAGCCAAAAGAAAAAGGAAGAATTA
GGTGAAAGCAATTTAGGTTCTGACAAAAAATGTGCTACTCAGTCTCAAAAAGGTGCTGAG
ACAAATGGTTAAAACTCAAAGGAATCCCAATAAAAGCCTGATGAATCAAAATCATAGCAA
GAAGAATCTTAATTAAAAGAAAAACCAAAAGCATAAAAAAGAAGATAAATAATAGATAGC
AGTGATGATGAAGAAGTTCCTTCATTGGCTACGATGTCTATAAGTAATAAGTAAATAAAA
AAAGTGGAAAATGAGAACTAAAAAAATGAGTCTTCTAAATCAGAAACAAAATCATCCACA
GATTCTAGCAATTTGTCGAAATAAATACTTGAAAAACCAAAAAATGAAGATGAAAAATTA
AGCCAATCATCTAAAAAAGCAGCAGAATAATAAGATACAAAAAAGAAACCAACTAATAAT
TTGAGAAAACTTTTGGATAAGCACTTTGACCCTATTGAAGACGCTCCATTCTATAAGGAT
TAAGAAGTCTTGTTTGGTTATTTATGTGATGGATTTGAAAGAGTAAATGAACAGGAAGGT
AAAAATTCAAAGGCTATACAAATTGAAATAATGTCAAAAATTTTCAAGTCGATCATATTA
CTTAATCCTGACTAGGTATATGAAGCTTATATGTTTTGTATTTTAAAGATAGCACCTGAT
TATGAGTCTAATGAGCTTGGTGTGGGTAGGGAAATACTTTAAAAAGCAATTAGTAATTGT
TGTGGTAAATCAGTTACTTAAATCAGAGATAGCCTTAATAAACTTGGTGACTTAGGTAAG
GTTGCGTCCGAAGCCAAATCTACCTAAAAAAACATCACAAATTATTTTTAAAAGCAGGCT
AAAGAAAAGCCTCCTATTACTCTTAATAGAACTTTTAATGATTTGAAAAGTATTGCAGCT
GCTTCAGGAAAGGACTCAACTGCAGAAAGAGAAAGAATTATTATAAAATATATGAATGAA
GCAAAACCAGATGAAGCATGCTATTTTATTAGATTTTTAGAGTAGAATTTGAAAATTGGT
GCTGCTGAAAAAACAATGTAGGCAGCTCTTTCCAAAGCATTCTTTGAAATTGCCCACAAT
ATCAAAAGCAATCACGTTTACACAGAATAATAAAACTAACTTTTAGAAGAATTTAACTTC
AATATCACTAGATGTCTGTGTGAGTTTCCAAACTATTACTAAGTCATTGAGACTTTGAAA
TAAATTGGCAAAGATATTTCTAAATTATTAGATATCTGCAAGATCACGATAGGCGTTCCC
TGCAAGCCTATGCTTGCCAAACCAACAAAATCAATTTAAGTTATTTTGGAAAGATTCAAA
GACATGACTTTTACTTGTGAATACAAGTATGATGGATTGAGAGGTCAAATACACTACGAT
GGAAAAGATGTTACTATTTTTAGCAGAAACCTAGAAAATATGACATAGATGTATCCTGAT
ATTGTAGAATTCATAAAAAAACATGTCAGCTAATCGAAAACTGTTAAAAATTTTATTTTA
GATAGTGAAATTGTAGCTTTTGATAAAAACACCAACAAAATTAGACCTTTCTAATAATTA
GCAACAAGAGGAAGAGTCAATGTCAAATTAGATGAAATTGATATAAAAGTTTGTGTTTTT
ATGTTCGATTTAATATATATCAATGACTAGAGTTTGCTACAAACAACACTTTAAGAAAGA
AGATAAAAAATTTAGGAGTGTTTTGTTCAAGAACCTGGTGAGTTCTGCTTTGCTGAGCAC
ATAAACACTGAAGATGTTGAACAAATTTAAGAATTCTTAGAAAAATCTGTTAAGGTGGGA
TGTGAAGGCTTGATGGTTAAAACTTTAGAAACTAACTCAACTTATGAACCAGCAAAAAGA
TCATTTAAATGGCTTAAACTCAAAAAAGATTATTTAGATAGTGGGTTAGGAGATACACTT
GATTTAGTTCCGATTGCAGCCTTCAAGGGTACAGGTAAAAGAGTTGGATTGTATGGTGCT
TACCTATTAGCTTGCTACAATGAAGATATGGAACGTTATGAAACAATATGTAAAATAGGT
ACAGGATTTTCAGATGAAATCTTAGAAGCATGCTATAAATTCTTCTAAGATAAAATTATA
CCATAGCCATAATCTGATTATTTAACCAAAGATTTTAAAGCAGATGTATGGTTTAAACCT
TCTGTAGTTTGGGAAATTAAGGGAGCAGATTTACAAATATCACCAGTATATACTTGTGCA
ATTAGTGAAACAAATTAAGAAAAAGGTATTGGTCTTAGATTCCCTCGTCTTATCAGAGTT
AGAGATGATAAAGATCCAGTCGATGCTACTTCTCCTTCTTTTATATACGATATATATAAA
CAATAAGCTGTTGTAGCAAATGATTTTGATGATGGTGATGATTTCTATTGA


>TTHERM_00348170(protein)
MKQGTIKNFFGNSQKKKEELGESNLGSDKKCATQSQKGAETNGQNSKESQQKPDESKSQQ
EESQLKEKPKAQKRRQIIDSSDDEEVPSLATMSISNKQIKKVENENQKNESSKSETKSST
DSSNLSKQILEKPKNEDEKLSQSSKKAAEQQDTKKKPTNNLRKLLDKHFDPIEDAPFYKD
QEVLFGYLCDGFERVNEQEGKNSKAIQIEIMSKIFKSIILLNPDQVYEAYMFCILKIAPD
YESNELGVGREILQKAISNCCGKSVTQIRDSLNKLGDLGKVASEAKSTQKNITNYFQKQA
KEKPPITLNRTFNDLKSIAAASGKDSTAERERIIIKYMNEAKPDEACYFIRFLEQNLKIG
AAEKTMQAALSKAFFEIAHNIKSNHVYTEQQNQLLEEFNFNITRCLCEFPNYYQVIETLK
QIGKDISKLLDICKITIGVPCKPMLAKPTKSIQVILERFKDMTFTCEYKYDGLRGQIHYD
GKDVTIFSRNLENMTQMYPDIVEFIKKHVSQSKTVKNFILDSEIVAFDKNTNKIRPFQQL
ATRGRVNVKLDEIDIKVCVFMFDLIYINDQSLLQTTLQERRQKIQECFVQEPGEFCFAEH
INTEDVEQIQEFLEKSVKVGCEGLMVKTLETNSTYEPAKRSFKWLKLKKDYLDSGLGDTL
DLVPIAAFKGTGKRVGLYGAYLLACYNEDMERYETICKIGTGFSDEILEACYKFFQDKII
PQPQSDYLTKDFKADVWFKPSVVWEIKGADLQISPVYTCAISETNQEKGIGLRFPRLIRV
RDDKDPVDATSPSFIYDIYKQQAVVANDFDDGDDFY


>TTHERM_00348170(gene)
ATGAAGCAAGGTACCATTAAAAACTTCTTTGGAAATAGCCAAAAGAAAAAGGAAGAATTA
GGTGAAAGCAATTTAGGTTCTGACAAAAAATGTGCTACTCAGTCTCAAAAAGGTGCTGAG
ACAAATGGTTAAAACTCAAAGGAATCCCAATAAAAGCCTGATGAATCAAAATCATAGCAA
GAAGAATCTTAATTAAAAGAAAAACCAAAAGCATAAAAAAGAAGATAAATAATAGATAGC
AGTGATGATGAAGAAGTTCCTTCATTGGCTACGATGTCTATAAGTAATAAGTAAATAAAA
AAAGTGGAAAATGAGAACTAAAAAAATGAGTCTTCTAAATCAGAAACAAAATCATCCACA
GATTCTAGCAATTTGTCGAAATAAATACTTGAAAAACCAAAAAATGAAGATGAAAAATTA
AGCCAATCATCTAAAAAAGCAGCAGAATAATAAGGTATGTGAAATTTAATCAATTTTTAA
ATATGATTTTTTTTATTTATTCTGTAGATACAAAAAAGAAACCAACTAATAATTTGAGAA
AACTTTTGGATAAGCACTTTGACCCTATTGAAGACGCTCCATTCTATAAGGATTAAGAAG
TCTTGTTTGGTTATTTATGTGATGGATTTGAAAGAGTAAATGAACAGGAAGGTAAAAATT
CAAAGGCTATACAAATTGAAATAATGTCAAAAATTTTCAAGTCGATCATATTACTTAATC
CTGACTAGGTATATGAAGCTTATATGTTTTGTATTTTAAAGATAGCACCTGATTATGAGT
CTAATGAGCTTGGTGTGGGTAGGGAAATACTTTAAAAAGCAATTAGTAATTGTTGTGGTA
AATCAGTTACTTAAATCAGAGATAGCCTTAATAAACTTGGTGACTTAGGTAAGGTTGCGT
CCGAAGCCAAATCTACCTAAAAAAACATCACAAATTATTTTTAAAAGCAGGCTAAAGAAA
AGCCTCCTATTACTCTTAATAGAACTTTTAATGATTTGAAAAGTATTGCAGCTGCTTCAG
GAAAGGTAAACAAACATAATTTATTTATTTATTGAACAACTCATAATTAAATGATTTATA
GGACTCAACTGCAGAAAGAGAAAGAATTATTATAAAATATATGAATGAAGCAAAACCAGA
TGAAGCATGCTATTTTATTAGATTTTTAGAGTAGAATTTGAAAATTGGTGCTGCTGAAAA
AACAATGTAGGCAGCTCTTTCCAAAGCATTCTTTGAAATTGCCCACAATATCAAAAGCAA
TCACGTTTACACAGAATAATAAAACTAACTTTTAGAAGAATTTAACTTCAATATCACTAG
ATGTCTGTGTGAGTTTCCAAACTATTACTAAGTCATTGAGACTTTGAAATAAATTGGCAA
AGATATTTCTAAATTATTAGATATCTGCAAGATCACGATAGGCGTTCCCTGCAAGCCTAT
GCTTGCCAAACCAACAAAATCAATTTAAGTAACAATAAATAAATATATAAATTATAAAGT
ATAATAAATTTACAAATACTTAAAGGTTATTTTGGAAAGATTCAAAGACATGACTTTTAC
TTGTGAATACAAGTATGATGGATTGAGAGGTCAAATACACTACGATGGAAAAGATGTTAC
TATTTTTAGCAGAAACCTAGAAAATATGACATAGATGTATCCTGATATTGTAGAATTCAT
AAAAAAACATGTCAGCTAATCGAAAACTGTTAAAAATTTTATTTTAGATAGTGAAATTGT
AGCTTTTGATAAAAACACCAACAAAATTAGACCTTTCTAATAATTAGCAACAAGAGGAAG
AGTCAATGTCAAATTAGATGAAATTGATATAAAAGTTTGTGTTTTTATGTTCGATTTAAT
ATATATCAATGACTAGAGTTTGCTACAAACAACACTTTAAGAAAGAAGATAAAAAATTTA
GGAGTGTTTTGTTCAAGAACCTGGTGAGTTCTGCTTTGCTGAGCACATAAACACTGAAGA
TGTTGAACAAATTTAAGTAAATTGATAACCAATTAATTATTGAAAAATTAACATCTATTT
TTTTTTTAGGAATTCTTAGAAAAATCTGTTAAGGTGGGATGTGAAGGCTTGATGGTTAAA
ACTTTAGAAACTAACTCAACTTATGAACCAGCAAAAAGATCATTTAAATGGCTTAAACTC
AAAAAAGATTATTTAGATAGTGGGTTAGGAGATACACTTGATTTAGTTCCGATTGCAGCC
TTCAAGGGTACAGGTAAAAGAGTTGGATTGTATGGTGCTTACCTATTAGCTTGCTACAAT
GAAGATATGGAACGTTATGAAACAATATGTAAAATAGGTACAGGATTTTCAGATGAAATC
TTAGAAGCATGCTATAAATTCTTCTAAGATAAAATTATACCATAGCCATAATCTGATTAT
TTAACCAAAGATTTTAAAGCAGATGTATGGTTTAAACCTTCTGTAGTTTGGGAAATTAAG
GGAGCAGATTTACAAATATCACCAGTATATACTTGTGCAATTAGTGAAACAAATTAAGAA
AAAGGTATTGGTCTTAGATTCCCTCGTCTTATCAGAGTTAGAGATGATAAAGATCCAGTC
GATGCTACTTCTCCTTCTTTTATATACGATATATATAAACAATAAGCTGTTGTAGCAAAT
GATTTTGATGATGGTGATGATTTCTATTGA