Identifiers and Description

Gene Model Identifier

TTHERM_00193390

Standard Name

LIA7 (localized in macronuclear anlagen 7)

Aliases

PreTt06622 | 16.m00278

Description

cyclin-dependent kinase-like Serine/Threonine kinase family protein; Protein kinase domain containing protein. Sequence similarity to the STE11 protein kinase family (Eisen et al.- 2006).

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase
  • ( PF06293 ) Lipopolysaccharide kinase (Kdo/WaaP) family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.2%

TetraMine Data

TTHERM_00193390

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03618.19.997093137033517e-262protein kinase domain-containi
ng protein (787 aa)
OxytrichaContig11718.0.g182.999564368270328e-76Protein kinase domain
DictyBaseDDB_G02832653.001032840497736e-70mkkA on chromosome: 4 position
530684 to 534789
SGDYJL095W2.0008958828286524e-54BCK1 Mitogen-activated protein
(MAP) kinase kinase kinase ac
ting in the protein kinase C s
ignaling pathway, which contro
ls cell integrity; upon activa
tion by Pkc1p phosphorylates d
ownstream kinases Mkk1p and Mk
k2p
WormBaseWBGene000015261.9991939848149086e-44locus:gck-1 status:Partially
_confirmed UniProt:H2L0A0
protein_id:CCD72151.2
Stentor CoeruleusSteCoe_240843.0144087850653746e-40

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:17519286: Yao MC, Yao CH, Halasz LM, Fuller P, Rexer CH, Wang SH, Jain R, Coyne RS, Chalker DL (2007) Identification of novel chromatin-associated proteins involved in programmed genome rearrangements in Tetrahymena. Journal of cell science 120(Pt 12):1978-89

Sequences

>TTHERM_00193390(coding)
ATGACTTTGTTATTTTGGTAAATTTAGATAAAGAAATAACAATTCTTGATAGATAATTTA
TAAAATTACTTAATAAACTAGTTTCAATATGGTAAATTGAATATAAATAATACACTAGAT
AATAGTATATTAAGGTAGAGGAACCAATTAAAAACTTGTAGAGTTGAATCTTTAAAGAAA
AACAATACAAGAAAAGAAACACCTAGCATACCAATTTAGTATAAAGTACTGTACCTATTT
ATAGAGTCTTTTAGATAAAATAGCAAATTAGTATATAATATAGTTGGATTGCTATCACTA
TTATTTTAGCAATAAATAAATAATTAGGATTCGGACTGGTTTAAAGAAATGAGCATGTTT
GATAAAGAATATGATAAAAAAGGATTTGATATAAAATAGATTTAAAGTCCAATATTGAAA
TTATATCAAAATGCCAAGTAGGAAATTAATAATAAAAGCGATAATATATTTTCTCCAAGC
CTCAACTCGTAAAATATCCAATCATCTAAGAAAATATATTAACATTAGCTATAACCGCTT
TAATTGGTTTAGAAAGATGATTAAAAGGAACACAAAAAGAAGCCTCAATCAATTTAGTCA
AGTGCATATGGTCGAGTTTATAAAGGATTTGTCAAGAGTACTGGAAAATTTATTGCAATA
AAAGAAATGAAAGAAGAAATGATGTTAGGAGAAGATGCTCACTCTTTATTAGAAAGCATT
TGCAAAGAGATTTAATTGCTGAAGTAGCTTTCTCATAAAAATATAGTAAACTACATTGGA
TCAAAAAAGCAAGAAGGTAGTGTGTATATTTACATGGAATATATGCCAGGAGGATCAATA
TCTGAAATGCTGAAAAAGTATGGAGGATTTGATGAAGAAGTTATTTAAAAATTTGTTAAA
CAGTTACTTGAAGGTTTAATTTATCTACATTCAAAAGGAGTTATTCATCGAGATTTAAAA
GGAGCAAATATTTTATCTGATGGTTAAGGCAATGTGAAGTTAGCAGATTTTGGAGCTGCT
AGAAATATAGAAAATATTTTGTAGCATTCTCTATCATAGTCAGAATTTTGCAATTCTATA
AAAGGATCCCTTTATTGGATGGCTCCAGAATTAATTAAAAATGAAAAACATGGAAGAAGA
ATAGATGTTTGGAGCTTGGGCTGTACTGTAATTGAAATGGCATCTGCTTAGCATCCATGG
GAAAACATTAAAAAATTCTCAGATTTAGCAAATGCTGTGATAGAATAATAACCCATACCA
ATACCTTAGCATTTGAGTGAAGAATGCAAAGATTTTATCTCGAAATGCTGCACTTATGAT
AAAAAAATGAGACCAAAATCTCAATAACTTTTTAATCACCCTTTTCTATAAAAAAAATAC
TCCTGA


>TTHERM_00193390(protein)
MTLLFWQIQIKKQQFLIDNLQNYLINQFQYGKLNINNTLDNSILRQRNQLKTCRVESLKK
NNTRKETPSIPIQYKVLYLFIESFRQNSKLVYNIVGLLSLLFQQQINNQDSDWFKEMSMF
DKEYDKKGFDIKQIQSPILKLYQNAKQEINNKSDNIFSPSLNSQNIQSSKKIYQHQLQPL
QLVQKDDQKEHKKKPQSIQSSAYGRVYKGFVKSTGKFIAIKEMKEEMMLGEDAHSLLESI
CKEIQLLKQLSHKNIVNYIGSKKQEGSVYIYMEYMPGGSISEMLKKYGGFDEEVIQKFVK
QLLEGLIYLHSKGVIHRDLKGANILSDGQGNVKLADFGAARNIENILQHSLSQSEFCNSI
KGSLYWMAPELIKNEKHGRRIDVWSLGCTVIEMASAQHPWENIKKFSDLANAVIEQQPIP
IPQHLSEECKDFISKCCTYDKKMRPKSQQLFNHPFLQKKYS


>TTHERM_00193390(gene)
ATGACTTTGTTATTTTGGTAAATTTAGATAAAGAAATAACAATTCTTGATAGATAATTTA
TAAAATTACTTAATAAACTAGTTTCAATATGGTAAATTGAATATAAATAATACACTAGAT
AATAGTATATTAAGGTAGAGGGTAAAAATTTAGGATTTTTTAATTATTCATTTAATTTCT
AAAAATTTATATTATTTTTAATATGCATTAATATAATATTTATTTATATATTAGAACCAA
TTAAAAACTTGTAGAGTTGAATCTTTAAAGAAAAACAATACAAGAAAAGAAACACCTAGC
ATACCAATTTAGTATAAAGTACTGTACCTATTTATAGAGTCTTTTAGATAAAATAGCAAA
TTAGTATATAATATAGTTGGATTGCTATCACTATTATTTTAGCAATAAATAAATAATTAG
GATTCGGACTGGTTTAAAGAAATGAGCATGTTTGATAAAGAATATGATAAAAAAGGATTT
GATATAAAATAGATTTAAAGTCCAATATTGAAATTATATCAAAATGCCAAGTAGGAAATT
AATAATAAAAGCGATAATATATTTTCTCCAAGCCTCAACTCGTAAAATATCCAATCATCT
AAGAAAAGTAAGCATAGTATTTATTATAATTCAAGTTGCACATTTAATTTAATAATTTAA
TCCAACATAATCAATTGTTCTCATCAAAAAATTAATTTTGCAAGAAAGAAAGGGAAAATT
TTTAAAAAGCAATAAAGTCAACTAACATTAACTCTTTTTTTGCAGTATATTAACATTAGC
TATAACCGCTTTAATTGGTTTAGAAAGATGATTAAAAGGAACACAAAAAGAAGCCTCAAT
CAATTTAGTCAAGTAAGCTTTAAACTTAAAAAAAATAATATTTTCAAAATTGTTTTCACT
TTTGATTCTATTAATATATGAATGATTATGCGGTTCATATAATTTCTAAAATTAGCAATT
AATTATTTTAAATTATAAAATTTGATAAAAAGGTGATCGAATCCTTTCAAAGGACTACTC
TAAAGGGAAAATTTTTTAAATTTAAAAAGATGAAATGAGTGGGTTTGCTATTAACAACTT
TAACAATAACAATAAATTAAGTGCCTTCCAAAGCTATCCATAATCACCCACTTACAAAGA
CTAATTTAATTGTAAATTGTAGAGTAAACAAAGTGAAGAGACTCCGACTTAAAAATCTTA
AAATTAACCTTTATATAGATTACCTAATAATGAAGCTAATCCTTTTAAGGATGGAAATTA
ATTGTAAATTTAGAATGATAATATAAAAGCTATAAAATTAGAAAGCGATTAGAAATCCAT
TTCTTAGCTTTAAAGTCCTAGAGTAAGGATTAAAACAATATAAAAAAATATGAAATCCCC
CACATATTAAAATCTAAACAAAGAAAAATTAAGTTAAAATGATTTAGCTGACTTTGAAAA
TTAGCAAAATTAAAATGGAGAGAAAATAAAAACAGAATAAAACAAAATAGATAACGAAGG
TCAATTTTAAGTCTAAAATGAGGAAGAACAAATATCACCAATAAAAAACAAAATTAATAA
AATTTAATCCATAAATGCTATTATACCAGAAAAATACCTCCCTAAGACACCATCGGGAGA
AAAATTTCATTAGAAATAGGAAAGTTCACGCCCAAGTTCAGGGAGAAATTAAAATTTTAT
TATAAAAATGGTCAATAATCACAATTATTCAGATGTCAATCATATACATAATAACAATTT
AAATAATGCAAATAATGGATCAAATACTGTTATAAGACTTTAGTCAAAAGAAATAAGTGA
TACACCCAAAAGCTAAAATAGAGAAGAAAAGTATTAAGAATCTTATAATGAAATTAAGGA
TAGAATCGACACCCAAAATTCATAATAAATAGGTGATTCTTTGTAAAATTTAGATGAAGA
ATAAAAAAAACGAAAAGCAAATTAGTGAACAAAAATAAAATAAACCTAATTCTAATTAGA
ATATATCTTCAAAAATATAATCCCTTAATTATATAAATGAAGAGAGAGAATTAGATTCAT
CTCCCATAGAATAAGGTTAAAATAGTAAACTGAAAGATAAAAATAATGATAAATAAAATA
TTATCAAAGAGTAATCATAAAATTAAAGATAAGAATCATCCATGATGTTACAAACAGCTT
CTGAAAAAAAAGAAATTAACAATTTAAAATATATTATTGAATCAAACAATTTAAATTAGA
ATAATAACAATAGCAGCAGCAATGATTATTTGGACGCATAAGTTGGGGAGTTAATTGGAT
AAGGTAAAATAGTAAATCAGATTTATTTAATTTTGGACAAATAAATTATTCAAAAGGTGC
ATATGGTCGAGTTTATAAAGGATTTGTCAAGAGTACTGGAAAATTTATTGCAATAAAAGA
AATGAAAGAAGAAATGATGTTAGGAGAAGATGCTCACTCTTTATTAGAAAGCATTTGCAA
AGAGATTTAATTGCTGAAGTAGCTTTCTCATAAAAATATAGTAAACTACATTGGATCAAA
AAAGCAAGAAGGTAGTGTGTATATTTACATGGAATATATGCCAGGAGGATCAATATCTGA
AATGCTGAAAAAGTATGGAGGATTTGATGAAGAAGTTATTTAAAAATTTGTTAAACAGTT
ACTTGAAGGTTTAATTTATCTACATTCAAAAGGAGTTATTCATCGAGATTTAAAAGTAAA
TATTACATTTAAACTTAAACAAATTTCAAATATTTATCTATTTATTTTAGGGAGCAAATA
TTTTATCTGATGGTTAAGGCAATGTGAAGTTAGCAGATTTTGGAGCTGCTAGAAATATAG
AAAATATTTTGTAGCATTCTCTATCATAGTCAGAATTTTGCAATTCTATAAAAGGGTAAA
ATAAATTTTATAAATTATTCTTTATCTTCAATTTAAACTAAAAAACTAAGAAATAATCAT
TTTACTGTTCTGAATTAAGTTTAAAACAAAATAATAAATAAAAAATGAAATATGATGTTA
TGAATTATTTGATAAAATATATTTATAATTCAAATTTAATGATAATAAAATTTTTAATTT
AGATCCCTTTATTGGATGGCTCCAGAATTAATTAAAAATGAAAAACATGGAAGAAGAATA
GATGTTTGGAGCTTGGGCTGTACTGTAATTGAAATGGCATCTGCTTAGCATCCATGGTAA
ATAAATTAATGTTAATAACTTAAATTGAAAATACATTGTTTATTAAATTAAATAAAGGGA
AAACATTAAAAAATTCTCAGATTTAGCAAATGCTGTGATAGAATAATAACCCATACCAAT
ACCTTAGCATTTGAGTGAAGAATGCAAAGATTTTATCTCGAAATGCTGCACTTATGATAA
AAAAATGAGACCAAAATCTCAATAACTTTTTAATCACCCTTTTCTATAAAAAAAATACTC
CTGA