Identifiers and Description

Gene Model Identifier

TTHERM_00193390

Standard Name

LIA7 (localized in macronuclear anlagen 7)

Aliases

PreTt06622 | 16.m00278

Description

Protein kinase domain containing protein. Sequence similarity to the STE11 protein kinase family (Eisen et al., 2006)."

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase
  • ( PF06293 ) Lipopolysaccharide kinase (Kdo/WaaP) family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.2%

TetraMine Data

TTHERM_00193390

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03618.19.997093137033517e-262protein kinase domain-containi
ng protein (787 aa)
OxytrichaContig11718.0.g182.999564368270328e-76Protein kinase domain
DictyBaseDDB_G02832653.001032840497736e-70mkkA on chromosome: 4 position
530684 to 534789
SGDYJL095W2.0008958828286524e-54BCK1 Mitogen-activated protein
(MAP) kinase kinase kinase ac
ting in the protein kinase C s
ignaling pathway, which contro
ls cell integrity; upon activa
tion by Pkc1p phosphorylates d
ownstream kinases Mkk1p and Mk
k2p
WormBaseWBGene000015261.9991939848149086e-44locus:gck-1 status:Partially
_confirmed UniProt:H2L0A0
protein_id:CCD72151.2
Stentor CoeruleusSteCoe_240843.0144087850653746e-40

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:17519286: Yao MC, Yao CH, Halasz LM, Fuller P, Rexer CH, Wang SH, Jain R, Coyne RS, Chalker DL (2007) Identification of novel chromatin-associated proteins involved in programmed genome rearrangements in Tetrahymena. Journal of cell science 120(Pt 12):1978-89

Sequences

>TTHERM_00193390(coding)
ATGACTTTGTTATTTTGGTAAATTTAGATAAAGAAATAACAATTCTTGATAGATAATTTA
TAAAATTACTTAATAAACTAGTTTCAATATGGTAAATTGAATATAAATAATACACTAGAT
AATAGTATATTAAGGTAGAGGAACCAATTAAAAACTTGTAGAGTTGAATCTTTAAAGAAA
AACAATACAAGAAAAGAAACACCTAGCATACCAATTTAGTATAAAGTACTGTACCTATTT
ATAGAGTCTTTTAGATAAAATAGCAAATTAGTATATAATATAGTTGGATTGCTATCACTA
TTATTTTAGCAATAAATAAATAATTAGGATTCGGACTGGTTTAAAGAAATGAGCATGTTT
GATAAAGAATATGATAAAAAAGGATTTGATATAAAATAGATTTAAAGTCCAATATTGAAA
TTATATCAAAATGCCAAGTAGGAAATTAATAATAAAAGCGATAATATATTTTCTCCAAGC
CTCAACTCGTAAAATATCCAATCATCTAAGAAAATATATTAACATTAGCTATAACCGCTT
TAATTGGTTTAGAAAGATGATTAAAAGGAACACAAAAAGAAGCCTCAATCAATTTAGTCA
AGTGATCGAATCCTTTCAAAGGACTACTCTAAAGGGAAAATTTTTTAAATTTAAAAAGAT
GAAATGAGTGGGTTTGCTATTAACAACTTTAACAATAACAATAAATTAAGTGCCTTCCAA
AGCTATCCATAATCACCCACTTACAAAGACTAATTTAATTGTAAATTGTAGAGTAAACAA
AGTGAAGAGACTCCGACTTAAAAATCTTAAAATTAACCTTTATATAGATTACCTAATAAT
GAAGCTAATCCTTTTAAGGATGGAAATTAATTGTAAATTTAGAATGATAATATAAAAGCT
ATAAAATTAGAAAGCGATTAGAAATCCATTTCTTAGCTTTAAAGTCCTAGAGTAAGGATT
AAAACAATATAAAAAAATATGAAATCCCCCACATATTAAAATCTAAACAAAGAAAAATTA
AGTTAAAATGATTTAGCTGACTTTGAAAATTAGCAAAATTAAAATGGAGAGAAAATAAAA
ACAGAATAAAACAAAATAGATAACGAAGGTCAATTTTAAGTCTAAAATGAGGAAGAACAA
ATATCACCAATAAAAAACAAAATTAATAAAATTTAATCCATAAATGCTATTATACCAGAA
AAATACCTCCCTAAGACACCATCGGGAGAAAAATTTCATTAGAAATAGGAAAGTTCACGC
CCAAGTTCAGGGAGAAATTAAAATTTTATTATAAAAATGGTCAATAATCACAATTATTCA
GATGTCAATCATATACATAATAACAATTTAAATAATGCAAATAATGGATCAAATACTGTT
ATAAGACTTTAGTCAAAAGAAATAAGTGATACACCCAAAAGCTAAAATAGAGAAGAAAAG
TATTAAGAATCTTATAATGAAATTAAGGATAGAATCGACACCCAAAATTCATAATAAATA
GGTGATTCTTTGTAAAATTTAGATGAAGAATAAAAAAACGAAAAGCAAATTAGTGAACAA
AAATAAAATAAACCTAATTCTAATTAGAATATATCTTCAAAAATATAATCCCTTAATTAT
ATAAATGAAGAGAGAGAATTAGATTCATCTCCCATAGAATAAGGTTAAAATAGTAAACTG
AAAGATAAAAATAATGATAAATAAAATATTATCAAAGAGTAATCATAAAATTAAAGATAA
GAATCATCCATGATGTTACAAACAGCTTCTGAAAAAAAAGAAATTAACAATTTAAAATAT
ATTATTGAATCAAACAATTTAAATTAGAATAATAACAATAGCAGCAGCAATGATTATTTG
GACGCATAAGTTGGGGAGTTAATTGGATAAGGTGCATATGGTCGAGTTTATAAAGGATTT
GTCAAGAGTACTGGAAAATTTATTGCAATAAAAGAAATGAAAGAAGAAATGATGTTAGGA
GAAGATGCTCACTCTTTATTAGAAAGCATTTGCAAAGAGATTTAATTGCTGAAGTAGCTT
TCTCATAAAAATATAGTAAACTACATTGGATCAAAAAAGCAAGAAGGTAGTGTGTATATT
TACATGGAATATATGCCAGGAGGATCAATATCTGAAATGCTGAAAAAGTATGGAGGATTT
GATGAAGAAGTTATTTAAAAATTTGTTAAACAGTTACTTGAAGGTTTAATTTATCTACAT
TCAAAAGGAGTTATTCATCGAGATTTAAAAGGAGCAAATATTTTATCTGATGGTTAAGGC
AATGTGAAGTTAGCAGATTTTGGAGCTGCTAGAAATATAGAAAATATTTTGTAGCATTCT
CTATCATAGTCAGAATTTTGCAATTCTATAAAAGGATCCCTTTATTGGATGGCTCCAGAA
TTAATTAAAAATGAAAAACATGGAAGAAGAATAGATGTTTGGAGCTTGGGCTGTACTGTA
ATTGAAATGGCATCTGCTTAGCATCCATGGGAAAACATTAAAAAATTCTCAGATTTAGCA
AATGCTGTGATAGAATAATAACCCATACCAATACCTTAGCATTTGAGTGAAGAATGCAAA
GATTTTATCTCGAAATGCTGCACTTATGATAAAAAAATGAGACCAAAATCTCAATAACTT
TTTAATCACCCTTTTCTATAAAAAAAATACTCCTGA


>TTHERM_00193390(protein)
MTLLFWQIQIKKQQFLIDNLQNYLINQFQYGKLNINNTLDNSILRQRNQLKTCRVESLKK
NNTRKETPSIPIQYKVLYLFIESFRQNSKLVYNIVGLLSLLFQQQINNQDSDWFKEMSMF
DKEYDKKGFDIKQIQSPILKLYQNAKQEINNKSDNIFSPSLNSQNIQSSKKIYQHQLQPL
QLVQKDDQKEHKKKPQSIQSSDRILSKDYSKGKIFQIQKDEMSGFAINNFNNNNKLSAFQ
SYPQSPTYKDQFNCKLQSKQSEETPTQKSQNQPLYRLPNNEANPFKDGNQLQIQNDNIKA
IKLESDQKSISQLQSPRVRIKTIQKNMKSPTYQNLNKEKLSQNDLADFENQQNQNGEKIK
TEQNKIDNEGQFQVQNEEEQISPIKNKINKIQSINAIIPEKYLPKTPSGEKFHQKQESSR
PSSGRNQNFIIKMVNNHNYSDVNHIHNNNLNNANNGSNTVIRLQSKEISDTPKSQNREEK
YQESYNEIKDRIDTQNSQQIGDSLQNLDEEQKNEKQISEQKQNKPNSNQNISSKIQSLNY
INEERELDSSPIEQGQNSKLKDKNNDKQNIIKEQSQNQRQESSMMLQTASEKKEINNLKY
IIESNNLNQNNNNSSSNDYLDAQVGELIGQGAYGRVYKGFVKSTGKFIAIKEMKEEMMLG
EDAHSLLESICKEIQLLKQLSHKNIVNYIGSKKQEGSVYIYMEYMPGGSISEMLKKYGGF
DEEVIQKFVKQLLEGLIYLHSKGVIHRDLKGANILSDGQGNVKLADFGAARNIENILQHS
LSQSEFCNSIKGSLYWMAPELIKNEKHGRRIDVWSLGCTVIEMASAQHPWENIKKFSDLA
NAVIEQQPIPIPQHLSEECKDFISKCCTYDKKMRPKSQQLFNHPFLQKKYS


>TTHERM_00193390(gene)
ATGACTTTGTTATTTTGGTAAATTTAGATAAAGAAATAACAATTCTTGATAGATAATTTA
TAAAATTACTTAATAAACTAGTTTCAATATGGTAAATTGAATATAAATAATACACTAGAT
AATAGTATATTAAGGTAGAGGGTAAAAATTTAGGATTTTTTAATTATTCATTTAATTTCT
AAAAATTTATATTATTTTTAATATGCATTAATATAATATTTATTTATATATTAGAACCAA
TTAAAAACTTGTAGAGTTGAATCTTTAAAGAAAAACAATACAAGAAAAGAAACACCTAGC
ATACCAATTTAGTATAAAGTACTGTACCTATTTATAGAGTCTTTTAGATAAAATAGCAAA
TTAGTATATAATATAGTTGGATTGCTATCACTATTATTTTAGCAATAAATAAATAATTAG
GATTCGGACTGGTTTAAAGAAATGAGCATGTTTGATAAAGAATATGATAAAAAAGGATTT
GATATAAAATAGATTTAAAGTCCAATATTGAAATTATATCAAAATGCCAAGTAGGAAATT
AATAATAAAAGCGATAATATATTTTCTCCAAGCCTCAACTCGTAAAATATCCAATCATCT
AAGAAAAGTAAGCATAGTATTTATTATAATTCAAGTTGCACATTTAATTTAATAATTTAA
TCCAACATAATCAATTGTTCTCATCAAAAAATTAATTTTGCAAGAAAGAAAGGGAAAATT
TTTAAAAAGCAATAAAGTCAACTAACATTAACTCTTTTTTTGCAGTATATTAACATTAGC
TATAACCGCTTTAATTGGTTTAGAAAGATGATTAAAAGGAACACAAAAAGAAGCCTCAAT
CAATTTAGTCAAGTAAGCTTTAAACTTAAAAAAAATAATATTTTCAAAATTGTTTTCACT
TTTGATTCTATTAATATATGAATGATTATGCGGTTCATATAATTTCTAAAATTAGCAATT
AATTATTTTAAATTATAAAATTTGATAAAAAGGTGATCGAATCCTTTCAAAGGACTACTC
TAAAGGGAAAATTTTTTAAATTTAAAAAGATGAAATGAGTGGGTTTGCTATTAACAACTT
TAACAATAACAATAAATTAAGTGCCTTCCAAAGCTATCCATAATCACCCACTTACAAAGA
CTAATTTAATTGTAAATTGTAGAGTAAACAAAGTGAAGAGACTCCGACTTAAAAATCTTA
AAATTAACCTTTATATAGATTACCTAATAATGAAGCTAATCCTTTTAAGGATGGAAATTA
ATTGTAAATTTAGAATGATAATATAAAAGCTATAAAATTAGAAAGCGATTAGAAATCCAT
TTCTTAGCTTTAAAGTCCTAGAGTAAGGATTAAAACAATATAAAAAAATATGAAATCCCC
CACATATTAAAATCTAAACAAAGAAAAATTAAGTTAAAATGATTTAGCTGACTTTGAAAA
TTAGCAAAATTAAAATGGAGAGAAAATAAAAACAGAATAAAACAAAATAGATAACGAAGG
TCAATTTTAAGTCTAAAATGAGGAAGAACAAATATCACCAATAAAAAACAAAATTAATAA
AATTTAATCCATAAATGCTATTATACCAGAAAAATACCTCCCTAAGACACCATCGGGAGA
AAAATTTCATTAGAAATAGGAAAGTTCACGCCCAAGTTCAGGGAGAAATTAAAATTTTAT
TATAAAAATGGTCAATAATCACAATTATTCAGATGTCAATCATATACATAATAACAATTT
AAATAATGCAAATAATGGATCAAATACTGTTATAAGACTTTAGTCAAAAGAAATAAGTGA
TACACCCAAAAGCTAAAATAGAGAAGAAAAGTATTAAGAATCTTATAATGAAATTAAGGA
TAGAATCGACACCCAAAATTCATAATAAATAGGTGATTCTTTGTAAAATTTAGATGAAGA
ATAAAAAAACGAAAAGCAAATTAGTGAACAAAAATAAAATAAACCTAATTCTAATTAGAA
TATATCTTCAAAAATATAATCCCTTAATTATATAAATGAAGAGAGAGAATTAGATTCATC
TCCCATAGAATAAGGTTAAAATAGTAAACTGAAAGATAAAAATAATGATAAATAAAATAT
TATCAAAGAGTAATCATAAAATTAAAGATAAGAATCATCCATGATGTTACAAACAGCTTC
TGAAAAAAAAGAAATTAACAATTTAAAATATATTATTGAATCAAACAATTTAAATTAGAA
TAATAACAATAGCAGCAGCAATGATTATTTGGACGCATAAGTTGGGGAGTTAATTGGATA
AGGTAAAATAGTAAATCAGATTTATTTAATTTTGGACAAATAAATTATTCAAAAGGTGCA
TATGGTCGAGTTTATAAAGGATTTGTCAAGAGTACTGGAAAATTTATTGCAATAAAAGAA
ATGAAAGAAGAAATGATGTTAGGAGAAGATGCTCACTCTTTATTAGAAAGCATTTGCAAA
GAGATTTAATTGCTGAAGTAGCTTTCTCATAAAAATATAGTAAACTACATTGGATCAAAA
AAGCAAGAAGGTAGTGTGTATATTTACATGGAATATATGCCAGGAGGATCAATATCTGAA
ATGCTGAAAAAGTATGGAGGATTTGATGAAGAAGTTATTTAAAAATTTGTTAAACAGTTA
CTTGAAGGTTTAATTTATCTACATTCAAAAGGAGTTATTCATCGAGATTTAAAAGTAAAT
ATTACATTTAAACTTAAACAAATTTCAAATATTTATCTATTTATTTTAGGGAGCAAATAT
TTTATCTGATGGTTAAGGCAATGTGAAGTTAGCAGATTTTGGAGCTGCTAGAAATATAGA
AAATATTTTGTAGCATTCTCTATCATAGTCAGAATTTTGCAATTCTATAAAAGGGTAAAA
TAAATTTTATAAATTATTCTTTATCTTCAATTTAAACTAAAAAACTAAGAAATAATCATT
TTACTGTTCTGAATTAAGTTTAAAACAAAATAATAAATAAAAAATGAAATATGATGTTAT
GAATTATTTGATAAAATATATTTATAATTCAAATTTAATGATAATAAAATTTTTAATTTA
GATCCCTTTATTGGATGGCTCCAGAATTAATTAAAAATGAAAAACATGGAAGAAGAATAG
ATGTTTGGAGCTTGGGCTGTACTGTAATTGAAATGGCATCTGCTTAGCATCCATGGTAAA
TAAATTAATGTTAATAACTTAAATTGAAAATACATTGTTTATTAAATTAAATAAAGGGAA
AACATTAAAAAATTCTCAGATTTAGCAAATGCTGTGATAGAATAATAACCCATACCAATA
CCTTAGCATTTGAGTGAAGAATGCAAAGATTTTATCTCGAAATGCTGCACTTATGATAAA
AAAATGAGACCAAAATCTCAATAACTTTTTAATCACCCTTTTCTATAAAAAAAATACTCC
TGA