Identifiers and Description

Gene Model Identifier

TTHERM_00849260

Standard Name

LIA6 (localized in macronuclear anlagen 6)

Aliases

PreTt24927 | 149.m00053 | 3750.m00283

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00849260

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18705.11.999489510516749e-128hypothetical protein (568 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:26688337: Kataoka K, Mochizuki K (2015) Phosphorylation of an HP1-like Protein Regulates Heterochromatin Body Assembly for DNA Elimination. Developmental cell 35(6):775-88
  2. Ref:17519286: Yao MC, Yao CH, Halasz LM, Fuller P, Rexer CH, Wang SH, Jain R, Coyne RS, Chalker DL (2007) Identification of novel chromatin-associated proteins involved in programmed genome rearrangements in Tetrahymena. Journal of cell science 120(Pt 12):1978-89

Sequences

>TTHERM_00849260(coding)
ATGGAAAGCTAAGTTGTAAATAATTCAGATGTTAAGAATCTTTAGACTCTCTCGATGATA
CTTGACACCTACCTTGAAAATTGTATTCAAAATACTGATTGGGAAAATAAAGCTAATTCT
TAAAGGGAGAAAGAAAAGCTTTACTAAAAAATTTTAAAGACCATAAACTAAATATTTAGC
AGGATTGGCGTTGCTGCAGCAACACTTGCTATGCAACCTTAATTGAATCCATAAGAAAAA
TAACTAAATGATGCTTAAGTTTAATAATAAGATTAAATAAACACTAATAAAAATCCCAAT
ATGGAAACTGAAAATGCAGTAAATGTAAATGGTTAGTTGAATTAAAATAAAGTTGACCAA
TTTTATGGAAACGGCTAAGCCCAAAAACTTTAAGATGGACAATAAGACAAAAATAACATG
GTTCAAGTAAATAAGAATCAAATGGAAGATGAGTCTGGCTATTGCTAAAAAGTTGTGATT
AATGCTCATCCTTTTAAGCAAAGATTAATTAACTAATAATAACGTATGTAGCAAGAGTTA
AAATAAAAGAACGATCAATAATCTGATGAAGAAGATTACGATCCACCAGATAATAGTAGT
GATAGTGATTTTAGATCAAGTGATGAAGAATATTCTGATAAAAAGAAAAAGTTAATTCAT
AAGAAAAAGCACAATAACTACTTCTCTTATAATAGCCAAAACACTTCACAAACATCTTCG
AGGCCAAGAGGCAGACCTCCCAGCTTTGCTAATAGTGAGAACGGTACAGTAAGCATATAA
GTAGCTCCAGTGAGTGAATAAAAAAAAATACTTGAGTACTTTAATCAACACTATGACCCA
TAAAAAAGGAATAAGATATATGTGATTAACTAGATCACCAAATAATTTAACTACTCCTAT
TCTAGTGTTTACTATCTCGTAACTAAATAGGTTGTAACAGAAGAACAAGAATACCATGAA
TAGATCTAGAAGCATAAACAATAATAGCATAGAAGCTCAAACTAATTCTAGACATAACTG
TAGAGGTAATAAATGTAATAATAGTAATATTACTAAAATTAGTTTAGTCAATATAGTTAT
AAAAGTGAATAATTTAATAATGGTTATCCTCGCTAAGGCCAATCGCAATCTTCTTAACTC
CACCAGAGTGACATGTAAAAAAGGAATCCTTCATATTATGAGTAGTAAAGGTAGTAGATG
AGAGAAAATAAAATATCTCCAAATGATCGTTTTGCTTAAAATCTTTTAAATTAACCAAAC
TCTCAACCTTCTTATAATACTTAAAATCAACAGCGTAGAAATCCTATCAATTAATACTCA
TAGTAGTAAGGAAATTATTAAAACAGTAACTATTAGGCCTAGGAAATGTCACAAACAGAC
TCAGACTCTGGGTTATTCCAAAACTAAGCACACAACAGATAGATGTATCCTAAGGCAGAA
GATGAATTGTTTAGAAATGATCTTAAGGTTGAATCCTTACAAGAATCTCGCAGAGTTAGT
GAGCAAGGATAAGATTTACAAGCAAAGCAAATTCCAGGCAATTAATAAAATCGTCTAGTC
TCATCAGAAAATAGATAAAATTTATATGGAGAATACCATCGCAGTGCCTCAAGTAGAGAT
ACTATTTAAATTTAGTAGAAGCAAGAATGA


>TTHERM_00849260(protein)
MESQVVNNSDVKNLQTLSMILDTYLENCIQNTDWENKANSQREKEKLYQKILKTINQIFS
RIGVAAATLAMQPQLNPQEKQLNDAQVQQQDQINTNKNPNMETENAVNVNGQLNQNKVDQ
FYGNGQAQKLQDGQQDKNNMVQVNKNQMEDESGYCQKVVINAHPFKQRLINQQQRMQQEL
KQKNDQQSDEEDYDPPDNSSDSDFRSSDEEYSDKKKKLIHKKKHNNYFSYNSQNTSQTSS
RPRGRPPSFANSENGTVSIQVAPVSEQKKILEYFNQHYDPQKRNKIYVINQITKQFNYSY
SSVYYLVTKQVVTEEQEYHEQIQKHKQQQHRSSNQFQTQLQRQQMQQQQYYQNQFSQYSY
KSEQFNNGYPRQGQSQSSQLHQSDMQKRNPSYYEQQRQQMRENKISPNDRFAQNLLNQPN
SQPSYNTQNQQRRNPINQYSQQQGNYQNSNYQAQEMSQTDSDSGLFQNQAHNRQMYPKAE
DELFRNDLKVESLQESRRVSEQGQDLQAKQIPGNQQNRLVSSENRQNLYGEYHRSASSRD
TIQIQQKQE


>TTHERM_00849260(gene)
ATGGAAAGCTAAGTTGTAAATAATTCAGATGTTAAGAATCTTTAGACTCTCTCGATGATA
CTTGACACCTACCTTGAAAATTGTATTCAAAATACTGATTGGGAAAATAAAGCTAATTCT
TAAAGGGAGAAAGAAAAGCTTTACTAAAAAATTTTAAAGACCATAAACTAAATATTTAGC
AGGATTGGCGTTGCTGCAGCAACACTTGCTATGCAACCTTAATTGAATCCATAAGAAAAA
TAACTAAATGATGCTTAAGTTTAATAATAAGATTAAATAAACACTAATAAAAATCCCAAT
ATGGAAACTGAAAATGCAGTAAATGTAAATGGTTAGTTGAATTAAAATAAAGTTGACCAA
TTTTATGGAAACGGCTAAGCCCAAAAACTTTAAGATGGACAATAAGACAAAAATAACATG
GTTCAAGTAAATAAGAATCAAATGGAAGATGAGTCTGGCTATTGCTAAAAAGTTGTGATT
AATGCTCATCCTTTTAAGCAAAGATTAATTAACTAATAATAACGTATGTAGCAAGAGTTA
AAATAAAAGAACGATCAATAATCTGATGTAAATTTTTTTTATATGAAATAATTTATTAAA
CTAACTTAAAATACTTTAGGAAGAAGATTACGATCCACCAGATAATAGTAGTGATAGTGA
TTTTAGATCAAGTGATGAAGAATATTCTGATAAAAAGAAAAAGTTAATTCATAAGAAAAA
GCACAATAACTACTTCTCTTATAATAGCCAAAACACTTCACAAACATCTTCGAGGCCAAG
AGGCAGACCTCCCAGCTTTGCTAATAGTGAGAACGGTACAGTAAGCATATAAGTAGCTCC
AGTGAGTGAATAAAAAAAAATACTTGAGTACTTTAATCAACACTATGACCCATAAAAAAG
GAATAAGATATATGTGATTAACTAGATCACCAAATAATTTAACTACTCCTATTCTAGTGT
TTACTATCTCGTAACTAAATAGGTTGTAACAGAAGAACAAGAATACCATGAATAGATCTA
GAAGCATAAACAATAATAGCATAGAAGCTCAAACTAATTCTAGACATAACTGTAGAGGTA
ATAAATGTAATAATAGTAATATTACTAAAATTAGTTTAGTCAATATAGTTATAAAAGTGA
ATAATTTAATAATGGTTATCCTCGCTAAGGCCAATCGCAATCTTCTTAACTCCACCAGAG
TGACATGTAAAAAAGGAATCCTTCATATTATGAGTAGTAAAGGTAGTAGATGAGAGAAAA
TAAAATATCTCCAAATGATCGTTTTGCTTAAAATCTTTTAAATTAACCAAACTCTCAACC
TTCTTATAATACTTAAAATCAACAGCGTAGAAATCCTATCAATTAATACTCATAGTAGTA
AGGAAATTATTAAAACAGTAACTATTAGGCCTAGGAAATGTCACAAACAGACTCAGACTC
TGGGTTATTCCAAAACTAAGCACACAACAGATAGATGTATCCTAAGGCAGAAGATGAATT
GTTTAGAAATGATCTTAAGGTTGAATCCTTACAAGAATCTCGCAGAGTTAGTGAGCAAGG
ATAAGATTTACAAGCAAAGCAAATTCCAGGCAATTAATAAAATCGTCTAGTCTCATCAGA
AAATAGATAAAATTTATATGGAGAATACCATCGCAGTGCCTCAAGGTAACAATACTTAAA
ATTAACTAAAACATATTTATATTTTAAATTTATAAAGTAGAGATACTATTTAAATTTAGT
AGAAGCAAGAATGA