Identifiers and Description

Gene Model Identifier

TTHERM_00653910

Standard Name

LIA5 (localized in macronuclear anlagen 5)

Aliases

PreTt12878 | 95.m00124 | 3825.m02531

Description

zinc finger protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00653910

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00713.19.997093137033517e-262hypothetical protein (905 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:28087716: Cheng CY, Young JM, Lin CG, Chao JL, Malik HS, Yao MC (2016) The piggyBac transposon-derived genes TPB1 and TPB6 mediate essential transposon-like excision during the developmental rearrangement of key genes in Tetrahymena thermophila. Genes & development 30(24):2724-2736
  2. Ref:24069402: Shieh AW, Chalker DL (2013) LIA5 is required for nuclear reorganization and programmed DNA rearrangements occurring during tetrahymena macronuclear differentiation. PloS one 8(9):e75337
  3. Ref:17519286: Yao MC, Yao CH, Halasz LM, Fuller P, Rexer CH, Wang SH, Jain R, Coyne RS, Chalker DL (2007) Identification of novel chromatin-associated proteins involved in programmed genome rearrangements in Tetrahymena. Journal of cell science 120(Pt 12):1978-89

Sequences

>TTHERM_00653910(coding)
ATGGAATTAGGAGAAGCAGATTTACATACATCACAATCAATAGTTTAGGAAGAAGTTCCT
ATGCAACAAGAGGTTAATATTCAAGAAGAATAAAATTCTTAATTTGACAATGTTTAATAA
CAAAATCAGAATGTAGAAGAATAACATTAAACAAATAAAAATAATTTAACTTAAAATGAT
TTTAATGAATTTCAATAATAAAATACAAATGAGCAAGACTTACCAAGAAACGATCAAACA
TAGGTTTAACCTCAATAAAACTTGTAGGATGAAAATAATTAAGACTAAACTATACATTTT
ACAGAGTAGCACTTTCAACAACGAGAAAGGGAATCTAGTGAAACTCATGATACAAGCAAT
TAAGAATTAGAATATTAAATTAATTAAAATATAAATGAAAATAAATAAGTACAAAAAGAT
AACTTAAATGAAGAAATTATATCTTAAAATAAAGAAGCACTTGATGGACAAGAAGATTAT
CAGAATTTCAATAAAAAAGATTTACCTGATAATAATAATAGTAATGAATAACATAACTAA
GATTAAGAAAATATGAATTAAATTGAAAGTTAAGAAGGTTAAAATTAATTAGTTTAGATA
GAAGTCAATGGTTCAGTGAATAGCCTATAAGAAAATAACTACATCTAAGATGGCACGTTT
ATGGAGTAAGAACATTTAAATGATAAAATGCAATAATAATAGGAATAGGCTGTAAAAGAA
GAAACTGAAGAAAGAGAAGAAATGTAAGAGGAGAATTAACTCCATGAAAATTAAGAAAAT
ATTAGTATCAGCTAATAAAATTAGTAAGCTCACAGTGATATGTAAATCGAAGTGTAAGCA
AATTAAATTAATTAATAAGAGAACCAGTTAGAATCTTTAAATGACAAGGAAGTTGTTAAA
GAAGAAAATAATTTGCTTTTAAATATACTTTCTGATGAAAATAATAAAAGATTTCAAAGA
CTTCCACCAGAATTGTCTCCCAATATTTTTTGTCATTTTTTGGGAGGCAAATCATTACAA
TTGACTAACATCAATGATTCTAGCAGGCTTTTTATGTATTTCTTGGGAACTAAGATATTA
AGATAGCTGCTTAATAAAGCAAATGTAAAGCTAAGAGAAATTTACAAGAAATAAAATGAC
GTTAAGGAATATACTATTGAAGAAATACAAGTCTATTAAGCTTTGAAAATTTTGATGGGT
TTACAATAAAACTCAAGCAATTTTGACTTTTTCCTTCTAAAAGATCTTCAAAAAATTCCT
CCATATCACCAACTCTTTACAAACGAAAGATTTTAATTCCTTCTTGATTGCGAAAGAGAG
TTAAATAAAGACATTTTAAATAATGAATAACTTATTTAAGACTTTGTTTAGAGAGCTTAA
AATTCCTAGACTTCTGATTAAGAATTGGTTTTAATATCAAAAAAAGGAAAAGTTGGTGAA
GAAATTATTCACAATAATTCTGTTTATACATAGATATTCTTATGTGAGTTGAGTTCAGCC
TTTGTTTTTGGCTACTTTGTTGTCAAAGATATGAGTTCTTTTGCAAATTAAATTTGTATA
AATTTAGAGAGTTTTACTAATCAAAACCATCATGTATATTTTTAGAACGAAGAATTTTTT
TCTAATTATGAAAAAATTTAAGAACTTTTGAATAGCAAAATACACATAAGTTCTTTTTTA
AATAACAAATTTGACTAATTTCCATAATCTCTTTAAAATGAAATGCTCCACAATAAACCA
TTAAAAGCAAATAACAGTGAGACTATATTTGATAGGCAGACTTAAACTTAGCTTCTTATT
AAATCGGATGAAAATTTAAAGAAAGAAGTCTTTTTAACTACCAGTGGTACAGTTAAATAA
GATAAAATGGTTGAAAAGCATAAGCAAGCAATTTAAAAAATAACTTAAAAGCTTAGAATG
CTACTAACAGAATACAGGTTTGTAAGTATCAATAATGATACGACATCTATCTTTGAAGAG
TTATCCGAGATAGCGATTTAAAACTCTTATATAATTTATTCCCAAGCAAAAGAAAAAATG
GATTACAGACTATTTAGATTTAAATTAGCATAAGATTTACTCTAAAAATAAATACAAAAG
ATAAAATAAGAGGAATTATAAAATGTTAAATCTAAACTAATTGATGTTGAAGTTTAAACA
GATAAAGTTGTTGAAAGTGTAATAAATGTTGAAACTCACGCTCTTTCTAAATCTCCAAAA
TCATCAGATAATAATGAATAGTTCATAATGAATGAAGTTAATTCACCTGTCTTTTAGGGA
AATGATTAAAATATCAGACAAGGAGGTACTCATGTCTAGAAAAAAGATGGTAAGTAAGGT
ATTTGCTTAGTTTGCTTACAAGAAAAAAATATTTAAAATAATACATTCATAACATGCTAA
GAATGCTCTTTACAAAATAAAAAGCCAGTTTATTTATGTGACAAGTGCTTTGAAGTATAT
CATTTAGAGATAAATGTTAACAGAGACAACTTTGATAAAAAAAATTTCTCTAGGCTAAGC
ACCCTAAAAAATTCAGTTACAACAGTTCCAATAGATAAAATGGCACCTAAGCCATTATAA
AATGGATATGGAAGTAATGGACTCAATGGAGGTTACAATACGGTTAATCCTCCTATTTAG
TAACCTTTAATGAACAATGGGTACAATGGATATTAACCATAATAAACTTAAGTGAGGAGA
AGAAGAACAGCTAATATTTAAGATGGGTATGAAACTTCAGGCCCTGCCTTTAACTCAATG
GTACCACCTCAAATGAATGGAAATATGATGGGATAATAAATTCCTTTAAAAAGAAGAGGA
CCTGCTTTGGATGACTCTGGATTTAGAAGTGATGCCCCTTCAAGCTATATTCCTGCTACA
AGAGGCAGAAAGAAATTAAATCATGGCTAAGACTAATTACCACCTAGAAATCAATATGGT
TACTCTGATTTAGGATAGCCAAACAACATGAATGGATATGGATAAGGGATGGGAAATAAT
GCAACAAATGGATATGATAGATACTCAAGAGGAGTTGACATGAATGGATATACTACTTCA
GATCCTGCATATGGCAGAAATTATCAAGGGGCAGATAATTACAATAATAATTAAATATAT
AGAGGTGTAGGTACTCAAAGAAAGTGA


>TTHERM_00653910(protein)
MELGEADLHTSQSIVQEEVPMQQEVNIQEEQNSQFDNVQQQNQNVEEQHQTNKNNLTQND
FNEFQQQNTNEQDLPRNDQTQVQPQQNLQDENNQDQTIHFTEQHFQQRERESSETHDTSN
QELEYQINQNINENKQVQKDNLNEEIISQNKEALDGQEDYQNFNKKDLPDNNNSNEQHNQ
DQENMNQIESQEGQNQLVQIEVNGSVNSLQENNYIQDGTFMEQEHLNDKMQQQQEQAVKE
ETEEREEMQEENQLHENQENISISQQNQQAHSDMQIEVQANQINQQENQLESLNDKEVVK
EENNLLLNILSDENNKRFQRLPPELSPNIFCHFLGGKSLQLTNINDSSRLFMYFLGTKIL
RQLLNKANVKLREIYKKQNDVKEYTIEEIQVYQALKILMGLQQNSSNFDFFLLKDLQKIP
PYHQLFTNERFQFLLDCERELNKDILNNEQLIQDFVQRAQNSQTSDQELVLISKKGKVGE
EIIHNNSVYTQIFLCELSSAFVFGYFVVKDMSSFANQICINLESFTNQNHHVYFQNEEFF
SNYEKIQELLNSKIHISSFLNNKFDQFPQSLQNEMLHNKPLKANNSETIFDRQTQTQLLI
KSDENLKKEVFLTTSGTVKQDKMVEKHKQAIQKITQKLRMLLTEYRFVSINNDTTSIFEE
LSEIAIQNSYIIYSQAKEKMDYRLFRFKLAQDLLQKQIQKIKQEELQNVKSKLIDVEVQT
DKVVESVINVETHALSKSPKSSDNNEQFIMNEVNSPVFQGNDQNIRQGGTHVQKKDGKQG
ICLVCLQEKNIQNNTFITCQECSLQNKKPVYLCDKCFEVYHLEINVNRDNFDKKNFSRLS
TLKNSVTTVPIDKMAPKPLQNGYGSNGLNGGYNTVNPPIQQPLMNNGYNGYQPQQTQVRR
RRTANIQDGYETSGPAFNSMVPPQMNGNMMGQQIPLKRRGPALDDSGFRSDAPSSYIPAT
RGRKKLNHGQDQLPPRNQYGYSDLGQPNNMNGYGQGMGNNATNGYDRYSRGVDMNGYTTS
DPAYGRNYQGADNYNNNQIYRGVGTQRK


>TTHERM_00653910(gene)
ATGGAATTAGGAGAAGCAGATTTACATACATCACAATCAATAGTTTAGGAAGAAGTTCCT
ATGCAACAAGAGGTTAATATTCAAGAAGAATAAAATTCTTAATTTGACAATGTTTAATAA
CAAAATCAGAATGTAGAAGAATAACATTAAACAAATAAAAATAATTTAACTTAAAATGAT
TTTAATGAATTTCAATAATAAAATACAAATGAGCAAGACTTACCAAGAAACGATCAAACA
TAGGTTTAACCTCAATAAAACTTGTAGGATGAAAATAATTAAGACTAAACTATACATTTT
ACAGAGTAGCACTTTCAACAACGAGAAAGGGAATCTAGTGAAACTCATGATACAAGCAAT
TAAGAATTAGAATATTAAATTAATTAAAATATAAATGAAAATAAATAAGTACAAAAAGAT
AACTTAAATGAAGAAATTATATCTTAAAATAAAGAAGCACTTGATGGACAAGAAGATTAT
CAGAATTTCAATAAAAAAGATTTACCTGATAATAATAATAGTAATGAATAACATAACTAA
GATTAAGAAAATATGAATTAAATTGAAAGTTAAGAAGGTTAAAATTAATTAGTTTAGATA
GAAGTCAATGGTTCAGTGAATAGCCTATAAGAAAATAACTACATCTAAGATGGCACGTTT
ATGGAGTAAGAACATTTAAATGATAAAATGCAATAATAATAGGAATAGGCTGTAAAAGAA
GAAACTGAAGAAAGAGAAGAAATGTAAGAGGAGAATTAACTCCATGAAAATTAAGTATTC
TTTAATTTTACTTATATTATTTTTAACTTAAACTTAAATTTTTAAGGAAAATATTAGTAT
CAGCTAATAAAATTAGTAAGCTCACAGTGATATGTAAATCGAAGTGTAAGCAAATTAAAT
TAATTAATAAGAGAACCAGTTAGAATCTTTAAATGACAAGGAAGTTGTTAAAGAAGAAAA
TAATTTGCTTTTAAATATACTTTCTGATGAAAATAATAAAAGATTTCAAAGACTTCCACC
AGAATTGTCTCCCAATATTTTTTGTCATTTTTTGGGAGGCAAATCATTACAATTGACTAA
CATCAATGATTCTAGCAGGCTTTTTATGTATTTCTTGGGAACTAAGATATTAAGATAGCT
GCTTAATAAAGCAAATGTAAAGCTAAGAGAAATTTACAAGAAATAAAATGACGTTAAGGA
ATATACTATTGAAGAAATACAAGTCTATTAAGCTTTGAAAATTTTGATGGGTTTACAATA
AAACTCAAGCAATTTTGACTTTTTCCTTCTAAAAGATCTTCAAAAAATTCCTCCATATCA
CCAACTCTTTACAAACGAAAGGTGGCTAATTTACAATTTTACAATTTTATATTTAAAATA
TTTTAATGTTTTAAAAATAGATTTTAATTCCTTCTTGATTGCGAAAGAGAGTTAAATAAA
GACATTTTAAATAATGAATAACTTATTTAAGACTTTGTTTAGAGAGCTTAAAATTCCTAG
ACTTCTGATTAAGAATTGGTTTTAATATCAAAAAAAGGAAAAGTTGGTGAAGAAATTATT
CACAATAATTCTGTTTATACATAGATATTCTTATGTGAGTTGAGTTCAGCCTTTGTTTTT
GGCTACTTTGTTGTCAAAGATATGAGTTCTTTTGCAAATTAAATTTGTATAAATTTAGAG
AGTTTTACTAATCAAAACCATCATGTATATTTTTAGAACGAAGAATTTTTTTCTAATTAT
GAAAAAATTTAAGAACTTTTGAATAGCAAAATACACATAAGTTCTTTTTTAAATAACAAA
TTTGACTAATTTCCATAATCTCTTTAAAATGAAATGCTCCACAATAAACCATTAAAAGCA
AATAACAGTGAGACTATATTTGATAGGCAGACTTAAACTTAGCTTCTTATTAAATCGGAT
GAAAATTTAAAGAAAGAAGTCTTTTTAACTACCAGTGGTACAGTTAAATAAGATAAAATG
GTTGAAAAGCATAAGCAAGCAATTTAAAAAATAACTTAAAAGCTTAGAATGCTACTAACA
GAATACAGGTTTGTAAGTATCAATAATGATACGACATCTATCTTTGAAGAGTTATCCGAG
ATAGCGATTTAAAACTCTTATATAATTTATTCCCAAGCAAAAGGTAAATAAAATGATAAA
AAATTTAATAACCATAATCTTTTTTATTTAAAAAATTTTTTTAAAATATTTAAATAGAAA
AAATGGATTACAGACTATTTAGATTTAAATTAGCATAAGATTTACTCTAAAAATAAATAC
AAAAGATAAAATAAGAGGAATTATAAAATGTTAAATCTAAACTAATTGATGTTGAAGTTT
AAACAGATAAAGTTGTTGAAAGTGTAATAAATGTTGAAACTCACGCTCTTTCTAAATCTC
CAAAATCATCAGATAATAATGAATAGTTCATAATGAATGAAGTTAATTCACCTGTCTTTT
AGGGAAATGATTAAGTAAAATTTTAAGAAAATAAACGAACATCTTATTAAATAATTATAA
TTTTTAGAATATCAGACAAGGAGGTACTCATGTCTAGAAAAAAGATGGTAAGTAAGGTAT
TTGCTTAGTTTGCTTACAAGAAAAAAATATTTAAAATAATACATTCATAACATGCTAAGA
ATGCTCTTTACAAAATAAAAAGCCAGTTTATTTATGTGACAAGTGCTTTGAAGTATATCA
TTTAGAGATGTATGATAAATATCAAATTTATTTTAATAGATTTTTATTTATTTTATTTTT
TGAAATAGAAATGTTAACAGAGACAACTTTGATAAAAAAAATTTCTCTAGGCTAAGCACC
CTAAAAAATTCAGTTACAACAGTTGTAATACAAACTTAATCATCCTTTCAAAATGAATAT
TTATGTATATTTTTAATCTAAAAAGCCAATAGATAAAATGGCACCTAAGCCATTATAAAA
TGGATATGGAAGTAATGGACTCAATGGAGGTTACAATACGGTTAATCCTCCTATTTAGTA
ACCTTTAATGAACAATGGGTACAATGGATATTAACCATAATAAACTTAAGTGAGGAGAAG
AAGAACAGCTAATATTTAAGATGGGTATGAAACTTCAGGCCCTGCCTTTAACTCAATGGT
ACCACCTCAAATGAATGGAAATATGATGGGATAATAAATTCCTTTAAAAAGAAGAGGACC
TGCTTTGGATGACTCTGGATTTAGAAGTGATGCCCCTTCGTAATTTTTCTTAGATATTTA
TAAATTTATCAAATAATTATTTTTTATAAACAGAAGCTATATTCCTGCTACAAGAGGCAG
AAAGAAATTAAATCATGGCTAAGACTAATTACCACCTAGAAATCAATATGGTTACTCTGA
TTTAGGATAGCCAAACAACATGAATGGATATGGATAAGGGATGGGAAATAATGCAACAAA
TGGATATGATAGATACTCAAGAGGAGTTGACATGAATGGATATACTACTTCAGATCCTGC
ATATGGCAGAAATTATCAAGGGGCAGATAATTACAATAATAATTAAATATATAGAGGTGT
AGGTACTCAAAGAAAGTGA